Property Summary

NCBI Gene PubMed Count 22
PubMed Score 39.25
PubTator Score 20.43

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95218 D3DQ75 Q53GS3 Q59F92 Q5VV33 Q5VV34 Q8IXN6 Q9UP63
Symbols ZIS
ZIS1
ZIS2
ZNF265

Gene

PDB

1N0Z   2K1P   3G9Y  

Gene RIF (3)

PMID Text
23666063 ZRANB2 is part of the supraspliceosome and causes differential splicing of numerous primary transcripts, some of which might have a role in cancer.
19052380 Crystallization of a ZRANB2-RNA complex
12657633 sites responsible for MRNA binding have been characterized.

AA Sequence

MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQ      1 - 70
CKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREESDGEYDEFGRKKKKYRGKAVG     71 - 140
PASILKEVEDKESEGEEEDEDEDLSKYKLDEDEDEDDADLSKYNLDASEEEDSNKKKSNRRSRSKSRSSH    141 - 210
SRSSSRSSSPSSSRSRSRSRSRSSSSSQSRSRSSSRERSRSRGSKSRSSSRSHRGSSSPRKRSYSSSSSS    211 - 280
PERNRKRSRSRSSSSGDRKKRRTRSRSPERRHRSSSGSSHSGSRSSSKKK                        281 - 330
//

Text Mined References (35)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23666063 2013 ZRANB2 localizes to supraspliceosomes and influences the alternative splicing of multiple genes in the transcriptome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...