Property Summary

NCBI Gene PubMed Count 22
PubMed Score 42.44
PubTator Score 20.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
active ulcerative colitis -1.104 2.0e-02
acute quadriplegic myopathy 1.093 6.4e-04
intraductal papillary-mucinous adenoma (... 1.100 4.9e-04
intraductal papillary-mucinous carcinoma... 1.200 7.5e-05
osteosarcoma 1.877 3.2e-06
ovarian cancer 2.100 7.7e-07
Pick disease -1.400 1.4e-05
progressive supranuclear palsy -1.400 1.5e-02

Gene RIF (3)

AA Sequence

MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQ      1 - 70
CKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREESDGEYDEFGRKKKKYRGKAVG     71 - 140
PASILKEVEDKESEGEEEDEDEDLSKYKLDEDEDEDDADLSKYNLDASEEEDSNKKKSNRRSRSKSRSSH    141 - 210
SRSSSRSSSPSSSRSRSRSRSRSSSSSQSRSRSSSRERSRSRGSKSRSSSRSHRGSSSPRKRSYSSSSSS    211 - 280
PERNRKRSRSRSSSSGDRKKRRTRSRSPERRHRSSSGSSHSGSRSSSKKK                        281 - 330
//

Text Mined References (35)

PMID Year Title