Property Summary

NCBI Gene PubMed Count 13
PubMed Score 31.61
PubTator Score 9.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 8.46087309889302E-18
ovarian cancer 8492 4.75592547120172E-7
acute quadriplegic myopathy 1157 8.29372570739456E-6
sonic hedgehog group medulloblastoma 1482 8.8945082077882E-6
malignant mesothelioma 3163 1.22411945373109E-5
cystic fibrosis 1670 2.54246569203335E-5
ependymoma 2514 3.85937344875675E-5
invasive ductal carcinoma 2950 2.63115642742095E-4
lung cancer 4473 5.07059552241897E-4
dermatomyositis 967 5.71837710001679E-4
osteosarcoma 7933 0.00358929903269334
subependymal giant cell astrocytoma 2287 0.0222146454846174
astrocytoma 1493 0.0234013051055959
spina bifida 1064 0.0437264419176384

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
osteosarcoma -1.044 0.004
ependymoma 1.100 0.000
cystic fibrosis 1.329 0.000
astrocytoma 1.100 0.023
acute quadriplegic myopathy 1.713 0.000
lung cancer -1.500 0.001
sonic hedgehog group medulloblastoma 1.600 0.000
subependymal giant cell astrocytoma 1.599 0.022
spina bifida 1.262 0.044
Breast cancer -1.700 0.000
invasive ductal carcinoma -1.100 0.000
ovarian cancer -2.300 0.000
dermatomyositis 1.200 0.001

Synonym

Accession O95199 B2RDW8
Symbols RLG
CHC1L

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12115502 decreased expression in prostate cancer associated with the difference in frequency of variant isoforms between normal and neoplastic prostate tissues places it in a pivotal role or possibly adjacent to a gene with that role in prostate cancer evolution

AA Sequence

MEEELPLFSGDSGKPVQATLSSLKMLDVGKWPIFSLCSEEELQLIRQACVFGSAGNEVLYTTVNDEIFVL      1 - 70
GTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGL     71 - 140
VPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPIPRRVTGCLQNKVVVTI    141 - 210
ACGQMCCMAVVDTGEVYVWGYNGNGQLGLGNSGNQPTPCRVAALQGIRVQRVACGYAHTLVLTDEGQVYA    211 - 280
WGANSYGQLGTGNKSNQSYPTPVTVEKDRIIEIAACHSTHTSAAKTQGGHVYMWGQCRGQSVILPHLTHF    281 - 350
SCTDDVFACFATPAVTWRLLSVEPDDHLTVAESLKREFDNPDTADLKFLVDGKYIYAHKVLLKIRCEHFR    351 - 420
SSLEDNEDDIVEMSEFSYPVYRAFLEYLYTDSISLSPEEAVGLLDLATFYRENRLKKLCQQTIKQGICEE    421 - 490
NAIALLSAAVKYDAQDLEEFCFRFCINHLTVVTQTSGFAEMDHDLLKNFISKASRVGAFKN             491 - 551
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20568903 2010 Expression of RAN, ZHX-2, and CHC1L genes in multiple myeloma patients and in myeloma cell lines treated with HDAC and Dnmts inhibitors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18353163 2008 Low expression of ZHX2, but not RCBTB2 or RAN, is associated with poor outcome in multiple myeloma.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14504426 2003 A culture device demonstrates that hydrostatic pressure increases mRNA of RGS5 in neuroblastoma and CHC1-L in lymphocytic cells.
12886522 2003 Extensive analysis of the 13q14 region in human prostate tumors: DNA analysis and quantitative expression of genes lying in the interval of deletion.
More...