Property Summary

NCBI Gene PubMed Count 14
PubMed Score 34.55
PubTator Score 9.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.713 8.3e-06
astrocytoma 1.100 2.3e-02
Breast cancer -1.700 8.5e-18
cystic fibrosis 1.329 2.5e-05
dermatomyositis 1.200 5.7e-04
ependymoma 1.100 3.9e-05
invasive ductal carcinoma -1.100 2.6e-04
lung cancer -1.500 5.1e-04
malignant mesothelioma -1.100 1.2e-05
osteosarcoma -1.044 3.6e-03
ovarian cancer -2.300 4.8e-07
sonic hedgehog group medulloblastoma 1.600 8.9e-06
spina bifida 1.262 4.4e-02
subependymal giant cell astrocytoma 1.599 2.2e-02

Gene RIF (2)

AA Sequence

MEEELPLFSGDSGKPVQATLSSLKMLDVGKWPIFSLCSEEELQLIRQACVFGSAGNEVLYTTVNDEIFVL      1 - 70
GTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGL     71 - 140
VPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPIPRRVTGCLQNKVVVTI    141 - 210
ACGQMCCMAVVDTGEVYVWGYNGNGQLGLGNSGNQPTPCRVAALQGIRVQRVACGYAHTLVLTDEGQVYA    211 - 280
WGANSYGQLGTGNKSNQSYPTPVTVEKDRIIEIAACHSTHTSAAKTQGGHVYMWGQCRGQSVILPHLTHF    281 - 350
SCTDDVFACFATPAVTWRLLSVEPDDHLTVAESLKREFDNPDTADLKFLVDGKYIYAHKVLLKIRCEHFR    351 - 420
SSLEDNEDDIVEMSEFSYPVYRAFLEYLYTDSISLSPEEAVGLLDLATFYRENRLKKLCQQTIKQGICEE    421 - 490
NAIALLSAAVKYDAQDLEEFCFRFCINHLTVVTQTSGFAEMDHDLLKNFISKASRVGAFKN             491 - 551
//

Text Mined References (14)

PMID Year Title