Property Summary

NCBI Gene PubMed Count 7
PubMed Score 15.69
PubTator Score 4.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.200 9.2e-03
malignant mesothelioma 2.600 1.5e-07
medulloblastoma, large-cell 2.200 1.2e-03

Synonym

Accession O95158 A8K4I4 Q7Z6L3 Q8N462
Symbols NPH4

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQLPEPRSSDGLGVGRAWSWAWP      1 - 70
TNHTGALARAGAAGALPAQRTKRKPSIKAARAKKIFGWGDFYFRVHTLKFSLLVTGKIVDHVNGTFSVYF     71 - 140
RHNSSSLGNLSVSIVPPSKRVEFGGVWLPGPVPHPLQSTLALEGVLPGLGPPLGMAAAAAGPGLGGSLGG    141 - 210
ALAGPLGGALGVPGAKESRAFNCHVEYEKTNRARKHRPCLYDPSQVCFTEHTQSQAAWLCAKPFKVICIF    211 - 280
VSFLSFDYKLVQKVCPDYNFQSEHPYFG                                              281 - 308
//

Text Mined References (7)

PMID Year Title