Property Summary

NCBI Gene PubMed Count 7
PubMed Score 15.71
PubTator Score 4.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 1.52804072600284E-7
medulloblastoma 1524 4.90183407963147E-4
medulloblastoma, large-cell 6234 0.00123208386946165

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 2.600 0.000
medulloblastoma 1.500 0.000
medulloblastoma, large-cell 2.200 0.001

Synonym

Accession O95158 A8K4I4 Q7Z6L3 Q8N462
Symbols NPH4

Gene

PANTHER Protein Class (1)

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid

AA Sequence

MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQLPEPRSSDGLGVGRAWSWAWP      1 - 70
TNHTGALARAGAAGALPAQRTKRKPSIKAARAKKIFGWGDFYFRVHTLKFSLLVTGKIVDHVNGTFSVYF     71 - 140
RHNSSSLGNLSVSIVPPSKRVEFGGVWLPGPVPHPLQSTLALEGVLPGLGPPLGMAAAAAGPGLGGSLGG    141 - 210
ALAGPLGGALGVPGAKESRAFNCHVEYEKTNRARKHRPCLYDPSQVCFTEHTQSQAAWLCAKPFKVICIF    211 - 280
VSFLSFDYKLVQKVCPDYNFQSEHPYFG                                              281 - 308
//

Text Mined References (7)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9570794 1998 Neurexophilins form a conserved family of neuropeptide-like glycoproteins.