Property Summary

NCBI Gene PubMed Count 10
Grant Count 6
R01 Count 4
Funding $843,676.5
PubMed Score 2.31
PubTator Score 6.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.300 0.001
osteosarcoma 1.561 0.000

AA Sequence

MQLTRCCFVFLVQGSLYLVICGQDDGPPGSEDPERDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLA      1 - 70
PPGEAWGILGQPPNRPNHSPPPSAKVKKIFGWGDFYSNIKTVALNLLVTGKIVDHGNGTFSVHFQHNATG     71 - 140
QGNISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCTHDPAKICSRDHAQSSATW    141 - 210
SCSQPFKVVCVYIAFYSTDYRLVQKVCPDYNYHSDTPYYPSG                                211 - 252
//

Text Mined References (11)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.
9856994 1998 Neurexophilin binding to alpha-neurexins. A single LNS domain functions as an independently folding ligand-binding unit.
9570794 1998 Neurexophilins form a conserved family of neuropeptide-like glycoproteins.
8699246 1996 Structure and evolution of neurexophilin.
More...