Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.31
PubTator Score 6.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 6.6e-04
psoriasis 6694 9.3e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.223 6.6e-04
psoriasis 1.300 9.3e-04

Synonym

Accession O95157 Q8NDC3 Q8TBF6 Q9ULR1
Symbols NPH3

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

AA Sequence

MQLTRCCFVFLVQGSLYLVICGQDDGPPGSEDPERDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLA      1 - 70
PPGEAWGILGQPPNRPNHSPPPSAKVKKIFGWGDFYSNIKTVALNLLVTGKIVDHGNGTFSVHFQHNATG     71 - 140
QGNISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCTHDPAKICSRDHAQSSATW    141 - 210
SCSQPFKVVCVYIAFYSTDYRLVQKVCPDYNYHSDTPYYPSG                                211 - 252
//

Text Mined References (11)

PMID Year Title