Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.36
PubTator Score 2.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
lung cancer -1.400 4.0e-03
adult high grade glioma 1.100 6.8e-03
astrocytic glioma 1.300 9.4e-03
atypical teratoid / rhabdoid tumor 1.100 1.4e-03
ependymoma 1.400 4.0e-03
hepatocellular carcinoma -1.100 3.4e-03
intraductal papillary-mucinous adenoma (... 1.900 4.2e-04
intraductal papillary-mucinous carcinoma... 1.700 3.7e-03
intraductal papillary-mucinous neoplasm ... 1.900 5.8e-03
malignant mesothelioma 1.800 2.4e-06
medulloblastoma 1.100 7.9e-04
oligodendroglioma 1.300 9.6e-04
osteosarcoma -1.313 7.9e-05
ovarian cancer -2.300 3.8e-11
Pick disease 1.600 2.8e-07
primitive neuroectodermal tumor 1.200 2.5e-03
psoriasis -2.500 3.3e-05
tuberculosis and treatment for 3 months 1.100 7.6e-04

Gene RIF (9)

AA Sequence

MDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYKVPGLYVIDSIV      1 - 70
RQSRHQFGTDKDVFGPRFSKNITATFQYLYLCPSEDKSKIVRVLNLWQKNGVFKIEIIQPLLDMAAGTSN     71 - 140
AAPVAENVTNNEGSPPPPVKVSSEPPTQATPNSVPAVPQLPSSDAFAAVAQLFQTTQGQQLQQILQTFQQ    141 - 210
PPKPQSPALDNAVMAQVQAITAQLKTTPTQPSEQKAAFPPPEQKTAFDKKLLDRFDYDDEPEAVEESKKE    211 - 280
DTTAVTTTAPAAAVPPAPTATVPAAAAPAAASPPPPQAPFGFPGDGMQQPAYTQHQNMDQFQPRMMGIQQ    281 - 350
DPMHHQVPLPPNGQMPGFGLLPTPPFPPMAQPVIPPTPPVQQPFQASFQAQNEPLTQKPHQQEMEVEQPC    351 - 420
IQEVKRHMSDNRKSRSRSASRSPKRRRSRSGSRSRRSRHRRSRSRSRDRRRHSPRSRSQERRDREKERER    421 - 490
RQKGLPQVKPETASVCSTTLWVGQLDKRTTQQDVASLLEEFGPIESINMIPPRGCAYIVMVHRQDAYRAL    491 - 560
QKLSRGNYKVNQKSIKIAWALNKGIKADYKQYWDVELGVTYIPWDKVKPEELESFCEGGMLDSDTLNPDW    561 - 630
KGIPKKPENEVAQNGGAETSHTEPVSPIPKPLPVPVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAF    631 - 700
TPPLGIPPPGFGPGVPPPPPPPPFLRPGFNPMHLPPGFLPPGPPPPITPPVSIPPPHTPPISIPNSTIAG    701 - 770
INEDTTKDLSIGNPIPTVVSGARGNAESGDSVKMYGSAVPPAAPTNLPTPPVTQPVSLLGTQGVAPGPVI    771 - 840
GLQAPSTGLLGARPGLIPLQRPPGMPPPHLQRFPLMPPRPMPPHMMHRGPPPGPGGFAMPPPHGMKGPFP    841 - 910
PHGPFVRPGGMPGLGGPGPGPGGPEDRDGRQQPPQQPQQQPQPQAPQQPQQQQQQQPPPSQQPPPTQQQP    911 - 980
QQFRNDNRQQFNSGRDQERFGRRSFGNRVENDRERYGNRNDDRDNSNRDRREWGRRSPDRDRHRDLEERN    981 - 1050
RRSSGHRDRERDSRDRESRREKEEARGKEKPEVTDRAGGNKTVEPPISQVGNVDTASELEKGVSEAAVLK   1051 - 1120
PSEELPAEATSSVEPEKDSGSAAEAPR                                              1121 - 1147
//

Text Mined References (29)

PMID Year Title