Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.30
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Down syndrome 548
Muscle Weakness 92
Disease Target Count P-value
ovarian cancer 8492 3.76025219231584E-11
Pick disease 1893 2.77942092993698E-7
malignant mesothelioma 3163 2.4337028986777E-6
tuberculosis and treatment for 6 months 686 1.74819742205026E-5
psoriasis 6685 3.32042469884377E-5
osteosarcoma 7933 7.88834461008776E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 4.24707467166614E-4
medulloblastoma 1524 7.8826078355981E-4
oligodendroglioma 2849 9.55377810738847E-4
atypical teratoid / rhabdoid tumor 4369 0.00140137424219686
primitive neuroectodermal tumor 3031 0.00247641812327327
hepatocellular carcinoma 550 0.00340961235253644
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00371906970096289
ependymoma 2514 0.00403150022525756
lung cancer 4473 0.00403466281327273
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00581862125422427
adult high grade glioma 2148 0.00676079686991017
astrocytic glioma 2241 0.00942439456178342
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession O95104 C9JLZ0 Q0P5W8 Q6P1M5 Q8N3I8 Q9UFM1 Q9ULP8
Symbols SRA4
SFRS15

Gene

  Ortholog (11)

Gene RIF (9)

PMID Text
24821155 Report frequency of SFRS15 SNPs in diabetic nephropathy.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
18550522 Describes function of the CTD-interacting domain of human SCAF8, human SCAF4, and similar proteins in S. cerevisiae.
17914031 Observational study of gene-disease association. (HuGE Navigator)
8692929 Describes identification of rat serine/arginine-rich splicing factors that interact with RNA polymerase II, including rA1, rA4, rA8, and rA9.

AA Sequence

MDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYKVPGLYVIDSIV      1 - 70
RQSRHQFGTDKDVFGPRFSKNITATFQYLYLCPSEDKSKIVRVLNLWQKNGVFKIEIIQPLLDMAAGTSN     71 - 140
AAPVAENVTNNEGSPPPPVKVSSEPPTQATPNSVPAVPQLPSSDAFAAVAQLFQTTQGQQLQQILQTFQQ    141 - 210
PPKPQSPALDNAVMAQVQAITAQLKTTPTQPSEQKAAFPPPEQKTAFDKKLLDRFDYDDEPEAVEESKKE    211 - 280
DTTAVTTTAPAAAVPPAPTATVPAAAAPAAASPPPPQAPFGFPGDGMQQPAYTQHQNMDQFQPRMMGIQQ    281 - 350
DPMHHQVPLPPNGQMPGFGLLPTPPFPPMAQPVIPPTPPVQQPFQASFQAQNEPLTQKPHQQEMEVEQPC    351 - 420
IQEVKRHMSDNRKSRSRSASRSPKRRRSRSGSRSRRSRHRRSRSRSRDRRRHSPRSRSQERRDREKERER    421 - 490
RQKGLPQVKPETASVCSTTLWVGQLDKRTTQQDVASLLEEFGPIESINMIPPRGCAYIVMVHRQDAYRAL    491 - 560
QKLSRGNYKVNQKSIKIAWALNKGIKADYKQYWDVELGVTYIPWDKVKPEELESFCEGGMLDSDTLNPDW    561 - 630
KGIPKKPENEVAQNGGAETSHTEPVSPIPKPLPVPVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAF    631 - 700
TPPLGIPPPGFGPGVPPPPPPPPFLRPGFNPMHLPPGFLPPGPPPPITPPVSIPPPHTPPISIPNSTIAG    701 - 770
INEDTTKDLSIGNPIPTVVSGARGNAESGDSVKMYGSAVPPAAPTNLPTPPVTQPVSLLGTQGVAPGPVI    771 - 840
GLQAPSTGLLGARPGLIPLQRPPGMPPPHLQRFPLMPPRPMPPHMMHRGPPPGPGGFAMPPPHGMKGPFP    841 - 910
PHGPFVRPGGMPGLGGPGPGPGGPEDRDGRQQPPQQPQQQPQPQAPQQPQQQQQQQPPPSQQPPPTQQQP    911 - 980
QQFRNDNRQQFNSGRDQERFGRRSFGNRVENDRERYGNRNDDRDNSNRDRREWGRRSPDRDRHRDLEERN    981 - 1050
RRSSGHRDRERDSRDRESRREKEEARGKEKPEVTDRAGGNKTVEPPISQVGNVDTASELEKGVSEAAVLK   1051 - 1120
PSEELPAEATSSVEPEKDSGSAAEAPR                                              1121 - 1147
//

Text Mined References (29)

PMID Year Title
24821155 2014 Single nucleotide polymorphisms at erythropoietin, superoxide dismutase 1, splicing factor, arginine/serin-rich 15 and plasmacytoma variant translocation genes association with diabetic nephropathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...