Property Summary

NCBI Gene PubMed Count 35
PubMed Score 21.56
PubTator Score 19.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Chronic Obstructive Airway Disease 37
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count
Pulmonary Fibrosis, Idiopathic 12

Expression

  Differential Expression (37)

Disease log2 FC p
acute quadriplegic myopathy 2.003 3.4e-05
aldosterone-producing adenoma -1.093 3.1e-02
Alzheimer's disease 1.200 4.0e-02
Amyotrophic lateral sclerosis 1.192 1.1e-04
atypical teratoid / rhabdoid tumor -2.200 1.4e-04
autosomal dominant Emery-Dreifuss muscul... 1.343 1.5e-02
Breast cancer -1.400 2.5e-12
breast carcinoma -1.800 1.9e-05
colon cancer -2.200 1.7e-02
cystic fibrosis 1.060 9.7e-04
dermatomyositis 1.700 2.0e-03
Duchenne muscular dystrophy 1.253 8.5e-05
ductal carcinoma in situ -1.900 6.7e-04
Endometriosis -1.195 4.9e-02
fibroadenoma -1.400 7.8e-03
glioblastoma -1.800 7.3e-04
group 4 medulloblastoma -1.700 6.3e-03
heterozygous familial hypercholesterolem... 1.058 2.1e-03
interstitial cystitis -1.100 1.8e-05
invasive ductal carcinoma -1.174 7.0e-03
juvenile dermatomyositis 1.634 4.1e-11
lung adenocarcinoma 1.044 1.0e-02
lung cancer -1.900 6.9e-04
lung carcinoma -1.300 4.9e-15
malignant mesothelioma -2.000 5.3e-07
medulloblastoma, large-cell 1.800 1.8e-06
Multiple myeloma 2.650 7.5e-04
ovarian cancer -2.600 2.3e-06
pancreatic cancer 1.200 6.2e-03
pancreatic carcinoma 1.200 6.2e-03
pancreatic ductal adenocarcinoma liver m... -1.269 3.1e-02
Pick disease 1.800 3.2e-05
primitive neuroectodermal tumor -1.300 1.0e-02
progressive supranuclear palsy 1.300 3.7e-02
psoriasis -1.500 9.6e-07
Rheumatoid arthritis 1.600 1.2e-02
ulcerative colitis -1.200 1.3e-04

Protein-protein Interaction (1)

Gene RIF (20)

AA Sequence

MGAGALAICQSKAAVRLKEDMKKIVAVPLNEQKDFTYQKLFGVSLQELERQGLTENGIPAVVWNIVEYLT      1 - 70
QHGLTQEGLFRVNGNVKVVEQLRLKFESGVPVELGKDGDVCSAASLLKLFLRELPDSLITSALQPRFIQL     71 - 140
FQDGRNDVQESSLRDLIKELPDTHYCLLKYLCQFLTKVAKHHVQNRMNVHNLATVFGPNCFHVPPGLEGM    141 - 210
KEQDLCNKIMAKILENYNTLFEVEYTENDHLRCENLARLIIVKEVYYKNSLPILLTRGLERDMPKPPPKT    211 - 280
KIPKSRSEGSIQAHRVLQPELSDGIPQLSLRLSYRKACLEDMNSAEGAISAKLVPSSQEDERPLSPFYLS    281 - 350
AHVPQVSNVSATGELLERTIRSAVEQHLFDVNNSGGQSSEDSESGTLSASSATSARQRRRQSKEQDEVRH    351 - 420
GRDKGLINKENTPSGFNHLDDCILNTQEVEKVHKNTFGCAGERSKPKRQKSSTKLSELHDNQDGLVNMES    421 - 490
LNSTRSHERTGPDDFEWMSDERKGNEKDGGHTQHFESPTMKIQEHPSLSDTKQQRNQDAGDQEESFVSEV    491 - 560
PQSDLTALCDEKNWEEPIPAFSSWQRENSDSDEAHLSPQAGRLIRQLLDEDSDPMLSPRFYAYGQSRQYL    561 - 630
DDTEVPPSPPNSHSFMRRRSSSLGSYDDEQEDLTPAQLTRRIQSLKKKIRKFEDRFEEEKKYRPSHSDKA    631 - 700
ANPEVLKWTNDLAKFRRQLKESKLKISEEDLTPRMRQRSNTLPKSFGSQLEKEDEKKQELVDKAIKPSVE    701 - 770
ATLESIQRKLQEKRAESSRPEDIKDMTKDQIANEKVALQKALLYYESIHGRPVTKNERQVMKPLYDRYRL    771 - 840
VKQILSRANTIPIIGSPSSKRRSPLLQPIIEGETASFFKEIKEEEEGSEDDSNVKPDFMVTLKTDFSARC    841 - 910
FLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFEDNFFRQN    911 - 980
GRNVQKEDRTPMAEEYSEYKHIKAKLRLLEVLISKRDTDSKSM                               981 - 1023
//

Text Mined References (41)

PMID Year Title