Property Summary

NCBI Gene PubMed Count 33
PubMed Score 18.40
PubTator Score 19.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 4.94200762832731E-15
psoriasis 6685 1.93747462670282E-13
Breast cancer 3099 1.14764688503916E-12
juvenile dermatomyositis 1189 4.11006486050421E-11
malignant mesothelioma 3163 1.70244946414379E-8
medulloblastoma, large-cell 6234 1.84642602715492E-6
ovarian cancer 8492 2.27776110623913E-6
cystic fibrosis 1670 5.88297104305395E-6
lung cancer 4473 6.19653049628466E-6
interstitial cystitis 2299 1.80326539231006E-5
breast carcinoma 1614 1.85832921149116E-5
Pick disease 1893 3.17494539101909E-5
acute quadriplegic myopathy 1157 3.39606726321454E-5
Duchenne muscular dystrophy 602 8.5311408305619E-5
Amyotrophic Lateral Sclerosis 432 1.08039861498237E-4
ulcerative colitis 2087 1.26950731914477E-4
atypical teratoid / rhabdoid tumor 4369 1.44542252898605E-4
lung adenocarcinoma 2714 4.75416969397842E-4
ductal carcinoma in situ 1745 6.73826950991278E-4
glioblastoma 5572 7.25811396336439E-4
Multiple myeloma 1328 7.51446278014114E-4
dermatomyositis 967 0.00201888849970665
pancreatic cancer 2300 0.00274524838905126
invasive ductal carcinoma 2950 0.00599732862659933
pancreatic carcinoma 567 0.0061776921736645
group 4 medulloblastoma 1875 0.00632604022024819
primary pancreatic ductal adenocarcinoma 1271 0.006705625071353
fibroadenoma 557 0.00777352086314217
primitive neuroectodermal tumor 3031 0.0101021518789724
Rheumatoid Arthritis 1171 0.0124781189087037
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0145269118283695
Endometriosis 535 0.0146322841931228
colon cancer 1475 0.0169310862340947
aldosterone-producing adenoma 664 0.0206801225594921
progressive supranuclear palsy 674 0.0374161326648669
Alzheimer's disease 644 0.0397310090515609
homozygous familial hypercholesterolemia 1 0.0397662671118753
Disease Target Count
Pulmonary Fibrosis, Idiopathic 12

Expression

  Differential Expression (37)

Synonym

Accession O94988 B4DLC1 Q24JP0 Q5PR21 Q8NBA3
Symbols FAM13A1
ARHGAP48

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (18)

PMID Text
26527870 FAM13A - candidate gene for Chronic Obstructive Pulmonary Disease identified by Genome-wide association studies.
26310313 This study confirms that the IREB2 variants contribute to an increased risk of lung cancer, whereas FAM13A predisposes to increased susceptibility to chronic obstructive pulmonary disease.
25609086 Fam13a may contribute to human lung diseases.
25608829 Data indicate that the FAM13A protein CTGA haplotypes interacted with heavy smoking to affect the risk of reduced pulmonary function.
25163686 This review gives a brief summary of the current knowledge of FAM13A, and demonstrates the necessity to resolve its biological function besides its well accepted genetic contribution.
24651745 CT quantitative analysis of lung parenchyma is very well correlated with COPD candidate gene FAM13A.
24587150 Haplotypes carrying major alleles of rs7671167 (C) of FAM13A had a protective effect on lung function amongst South Indian male smokers with COPD.
23891779 the FAM13A locus might be a contributor to chronic obstructive pulmonary disease susceptibility in Chinese Han population.
23169000 FAM13A1 is one of the top hub genes associated with human Treg suppressor function. See Table 1 of the publication.
22027142 these results support that FAM13A rs2869967 and XRCC5 rs3821104 are associated with COPD in Chinese Han population.
More...

AA Sequence

MGAGALAICQSKAAVRLKEDMKKIVAVPLNEQKDFTYQKLFGVSLQELERQGLTENGIPAVVWNIVEYLT      1 - 70
QHGLTQEGLFRVNGNVKVVEQLRLKFESGVPVELGKDGDVCSAASLLKLFLRELPDSLITSALQPRFIQL     71 - 140
FQDGRNDVQESSLRDLIKELPDTHYCLLKYLCQFLTKVAKHHVQNRMNVHNLATVFGPNCFHVPPGLEGM    141 - 210
KEQDLCNKIMAKILENYNTLFEVEYTENDHLRCENLARLIIVKEVYYKNSLPILLTRGLERDMPKPPPKT    211 - 280
KIPKSRSEGSIQAHRVLQPELSDGIPQLSLRLSYRKACLEDMNSAEGAISAKLVPSSQEDERPLSPFYLS    281 - 350
AHVPQVSNVSATGELLERTIRSAVEQHLFDVNNSGGQSSEDSESGTLSASSATSARQRRRQSKEQDEVRH    351 - 420
GRDKGLINKENTPSGFNHLDDCILNTQEVEKVHKNTFGCAGERSKPKRQKSSTKLSELHDNQDGLVNMES    421 - 490
LNSTRSHERTGPDDFEWMSDERKGNEKDGGHTQHFESPTMKIQEHPSLSDTKQQRNQDAGDQEESFVSEV    491 - 560
PQSDLTALCDEKNWEEPIPAFSSWQRENSDSDEAHLSPQAGRLIRQLLDEDSDPMLSPRFYAYGQSRQYL    561 - 630
DDTEVPPSPPNSHSFMRRRSSSLGSYDDEQEDLTPAQLTRRIQSLKKKIRKFEDRFEEEKKYRPSHSDKA    631 - 700
ANPEVLKWTNDLAKFRRQLKESKLKISEEDLTPRMRQRSNTLPKSFGSQLEKEDEKKQELVDKAIKPSVE    701 - 770
ATLESIQRKLQEKRAESSRPEDIKDMTKDQIANEKVALQKALLYYESIHGRPVTKNERQVMKPLYDRYRL    771 - 840
VKQILSRANTIPIIGSPSSKRRSPLLQPIIEGETASFFKEIKEEEEGSEDDSNVKPDFMVTLKTDFSARC    841 - 910
FLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFEDNFFRQN    911 - 980
GRNVQKEDRTPMAEEYSEYKHIKAKLRLLEVLISKRDTDSKSM                               981 - 1023
//

Text Mined References (39)

PMID Year Title
26527870 2015 Candidate genes for COPD: current evidence and research.
26310313 2015 Susceptibility loci in lung cancer and COPD: association of IREB2 and FAM13A with pulmonary diseases.
25609086 2015 Regulation of nuclear-cytoplasmic shuttling and function of Family with sequence similarity 13, member A (Fam13a), by B56-containing PP2As and Akt.
25608829 2015 Identification of FAM13A gene associated with the ratio of FEV1 to FVC in Korean population by genome-wide association studies including gene-environment interactions.
25241909 2014 Genetic susceptibility for chronic bronchitis in chronic obstructive pulmonary disease.
25163686 2014 Moving beyond genetics: is FAM13A a major biological contributor in lung physiology and chronic lung diseases?
25101718 2015 IREB2 and GALC are associated with pulmonary artery enlargement in chronic obstructive pulmonary disease.
24651745 Quantitative analysis of lungs and airways with CT in subjects with the chronic obstructive pulmonary disease (COPD) candidate FAM13A gene: case control study for CT quantification in COPD risk gene.
24621683 2014 Risk loci for chronic obstructive pulmonary disease: a genome-wide association study and meta-analysis.
24587150 2014 Genetic determinants of chronic obstructive pulmonary disease in South Indian male smokers.
More...