Property Summary

NCBI Gene PubMed Count 38
Grant Count 4
Funding $119,534.75
PubMed Score 12.44
PubTator Score 19.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.236 0.008
osteosarcoma 1.199 0.002
astrocytoma 1.400 0.007
autosomal dominant Emery-Dreifuss muscul... 1.127 0.002
juvenile dermatomyositis 1.336 0.000
acute quadriplegic myopathy 1.376 0.000
lung adenocarcinoma 1.214 0.000
ovarian cancer -2.400 0.000

Gene RIF (17)

PMID Text
25667979 Results show the crystal structure of the complex between ALG-2 and a peptide of Sec31A and found that the peptide binds to the third hydrophobic pocket (Pocket 3) and that ALG-2 recognizing 2 types of motifs at different hydrophobic surfaces of Sec31A.
25540196 findings suggest that AnxA11 maintains architectural and functional features of the ERES by coordinating with ALG-2 to stabilize Sec31A at the ERES.
25006245 ALG-2/Sec31A interactions were not required for the localization of Sec31A to ER exit sites per se but appeared to acutely regulate the stability and trafficking of the cargo receptor p24 and the distribution of the vesicle tether protein p115
24825317 HIV-1 gp120/MBL complex co-localizes with intracellular COPII vesicle markers Sec31A and Sec13 in neuronal cells
24069399 ALG-2 attenuates COPII budding in vitro and stabilizes the Sec23/Sec31A complex.
23349870 These results suggest that Sec31 phosphorylation by CK2 controls the duration of COPII vesicle formation, which regulates ER-to-Golgi trafficking.
22331354 efficient COPII-dependent secretion, notably assembly of Sec13-Sec31, is required to drive epithelial morphogenesis in both two- and three-dimensional cultures
21325169 t(4;9)(q21;p24) leads to a novel SEC31A-JAK2 fusion in Hodgkin lymphoma
21109691 SEC31A-ALK fusions are recurrent in ALK-positive large B-cell lymphomas.
20834162 the alg2 binding site is one of the key determinants of the retention kinetics of Sec31A at endoplasmic reticulum exit sites
More...

AA Sequence

MKLKEVDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSCATFSSSHRYH      1 - 70
KLIWGPYKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQNDKHTGPVRALDVNIFQTNLVAS     71 - 140
GANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQVQHILASASPSGRATVWDLRKNEPIIKVSDH    141 - 210
SNRMHCSGLAWHPDVATQMVLASEDDRLPVIQMWDLRFASSPLRVLENHARGILAIAWSMADPELLLSCG    211 - 280
KDAKILCSNPNTGEVLYELPTNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLS    281 - 350
SSFGNLDPFGTGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVRMPSHQGAEQ    351 - 420
QQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKIDASQTEFEKNVWSFLKVNFEDDSRGKYL    421 - 490
ELLGYRKEDLGKKIALALNKVDGANVALKDSDQVAQSDGEESPAAEEQLLGEHIKEEKEESEFLPSSGGT    491 - 560
FNISVSGDIDGLITQALLTGNFESAVDLCLHDNRMADAIILAIAGGQELLARTQKKYFAKSQSKITRLIT    561 - 630
AVVMKNWKEIVESCDLKNWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEK    631 - 700
LVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFL    701 - 770
PDNTNQPNIMQLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPP    771 - 840
PGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQPYQPAQPYPFGTGGSAMYRPQQPVAPPTSNAYPNT    841 - 910
PYISSASSYTGQSQLYAAQHQASSPTSSPATSFPPPPSSGASFQHGGPGAPPSSSAYALPPGTTGTLPAA    911 - 980
SELPASQRTGPQNGWNDPPALNRVPKKKKMPENFMPPVPITSPIMNPLGDPQSQMLQQQPSAPVPLSSQS    981 - 1050
SFPQPHLPGGQPFHGVQQPLGQTGMPPSFSKPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILK   1051 - 1120
TTFEDLIQRCLSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHT   1121 - 1190
HIVSTSNFSETSAFMPVLKVVLTQANKLGV                                           1191 - 1220
//

Text Mined References (53)

PMID Year Title
27565346 2016 Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25667979 2015 Structural analysis of the complex between penta-EF-hand ALG-2 protein and Sec31A peptide reveals a novel target recognition mechanism of ALG-2.
25540196 2015 A new role for annexin A11 in the early secretory pathway via stabilizing Sec31A protein at the endoplasmic reticulum exit sites (ERES).
25416956 2014 A proteome-scale map of the human interactome network.
25006245 2014 Apoptosis-linked gene-2 (ALG-2)/Sec31 interactions regulate endoplasmic reticulum (ER)-to-Golgi transport: a potential effector pathway for luminal calcium.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24069399 2013 ALG-2 attenuates COPII budding in vitro and stabilizes the Sec23/Sec31A complex.
23349870 2013 CK2 phosphorylates Sec31 and regulates ER-To-Golgi trafficking.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...