Property Summary

NCBI Gene PubMed Count 41
PubMed Score 12.99
PubTator Score 19.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Lymphoma, Large B-Cell, Diffuse 34 0.0 0.0
Disease Target Count
Diffuse large B-cell lymphoma 39
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Stomatitis 21 3.166 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.376 2.0e-06
astrocytoma 1.400 6.8e-03
autosomal dominant Emery-Dreifuss muscul... 1.127 2.4e-03
juvenile dermatomyositis 1.336 1.9e-12
lung adenocarcinoma 1.214 2.2e-08
osteosarcoma 1.199 1.9e-03
ovarian cancer -2.400 2.9e-10
Waldenstrons macroglobulinemia 1.236 8.1e-03

Protein-protein Interaction (7)

Gene RIF (17)

AA Sequence

MKLKEVDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSCATFSSSHRYH      1 - 70
KLIWGPYKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQNDKHTGPVRALDVNIFQTNLVAS     71 - 140
GANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQVQHILASASPSGRATVWDLRKNEPIIKVSDH    141 - 210
SNRMHCSGLAWHPDVATQMVLASEDDRLPVIQMWDLRFASSPLRVLENHARGILAIAWSMADPELLLSCG    211 - 280
KDAKILCSNPNTGEVLYELPTNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLS    281 - 350
SSFGNLDPFGTGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVRMPSHQGAEQ    351 - 420
QQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKIDASQTEFEKNVWSFLKVNFEDDSRGKYL    421 - 490
ELLGYRKEDLGKKIALALNKVDGANVALKDSDQVAQSDGEESPAAEEQLLGEHIKEEKEESEFLPSSGGT    491 - 560
FNISVSGDIDGLITQALLTGNFESAVDLCLHDNRMADAIILAIAGGQELLARTQKKYFAKSQSKITRLIT    561 - 630
AVVMKNWKEIVESCDLKNWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEK    631 - 700
LVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFL    701 - 770
PDNTNQPNIMQLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPP    771 - 840
PGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQPYQPAQPYPFGTGGSAMYRPQQPVAPPTSNAYPNT    841 - 910
PYISSASSYTGQSQLYAAQHQASSPTSSPATSFPPPPSSGASFQHGGPGAPPSSSAYALPPGTTGTLPAA    911 - 980
SELPASQRTGPQNGWNDPPALNRVPKKKKMPENFMPPVPITSPIMNPLGDPQSQMLQQQPSAPVPLSSQS    981 - 1050
SFPQPHLPGGQPFHGVQQPLGQTGMPPSFSKPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILK   1051 - 1120
TTFEDLIQRCLSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHT   1121 - 1190
HIVSTSNFSETSAFMPVLKVVLTQANKLGV                                           1191 - 1220
//

Text Mined References (56)

PMID Year Title