Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.78
PubTator Score 1.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Weight Gain 100 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Mast cell neoplasm 8 3.303 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 3.2e-04
Breast cancer 2.400 2.9e-02
Chronic Lymphocytic Leukemia 1.486 6.1e-03
lung adenocarcinoma -1.300 2.4e-10
osteosarcoma 2.713 1.6e-08
ovarian cancer -1.800 1.5e-03
Parkinson's disease -1.100 1.2e-02
psoriasis -1.200 3.1e-04
subependymal giant cell astrocytoma -1.820 3.7e-03

Synonym

Accession O94952 B3KMF0 Q5BJG0 Q9H087
Symbols FBX21

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MAAAAVDSAMEVVPALAEEAAPEVAGLSCLVNLPGEVLEYILCCGSLTAADIGRVSSTCRRLRELCQSSG      1 - 70
KVWKEQFRVRWPSLMKHYSPTDYVNWLEEYKVRQKAGLEARKIVASFSKRFFSEHVPCNGFSDIENLEGP     71 - 140
EIFFEDELVCILNMEGRKALTWKYYAKKILYYLRQQKILNNLKAFLQQPDDYESYLEGAVYIDQYCNPLS    141 - 210
DISLKDIQAQIDSIVELVCKTLRGINSRHPSLAFKAGESSMIMEIELQSQVLDAMNYVLYDQLKFKGNRM    211 - 280
DYYNALNLYMHQVLIRRTGIPISMSLLYLTIARQLGVPLEPVNFPSHFLLRWCQGAEGATLDIFDYIYID    281 - 350
AFGKGKQLTVKECEYLIGQHVTAALYGVVNVKKVLQRMVGNLLSLGKREGIDQSYQLLRDSLDLYLAMYP    351 - 420
DQVQLLLLQARLYFHLGIWPEKSFCLVLKVLDILQHIQTLDPGQHGAVGYLVQHTLEHIERKKEEVGVEV    421 - 490
KLRSDEKHRDVCYSIGLIMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGHHQPFYNVLVEDGSC    491 - 560
RYAAQENLEYNVEPQEISHPDVGRYFSEFTGTHYIPNAELEIRYPEDLEFVYETVQNIYSAKKENIDE      561 - 628
//

Text Mined References (12)

PMID Year Title