Property Summary

NCBI Gene PubMed Count 69
PubMed Score 716.88
PubTator Score 146.61

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
ependymoma 2514 1.16168639387415E-24
oligodendroglioma 2849 3.51394569364768E-21
lung carcinoma 2844 2.57275405749641E-19
ovarian cancer 8492 4.30178486451841E-14
atypical teratoid / rhabdoid tumor 4369 2.00086763491825E-12
pilocytic astrocytoma 3086 6.21189393973154E-12
medulloblastoma 1524 1.79938508957095E-11
juvenile dermatomyositis 1189 2.20548130857462E-9
pediatric high grade glioma 2712 3.03351746994145E-9
non-small cell lung cancer 2798 5.97476722160383E-9
glioblastoma 5572 8.48732851738635E-8
malignant mesothelioma 3163 1.13301512493674E-7
tuberculosis 1563 3.63923732807798E-6
medulloblastoma, large-cell 6234 5.15671087602378E-6
osteosarcoma 7933 1.36597195948861E-5
psoriasis 6685 1.84436402031049E-5
lung cancer 4473 3.80928338371623E-5
Atopic dermatitis 944 2.48559022222736E-4
primitive neuroectodermal tumor 3031 4.65041458163164E-4
cutaneous lupus erythematosus 1056 5.17463994353663E-4
interstitial cystitis 2299 5.77015789771206E-4
pituitary cancer 1972 7.05543842017675E-4
Pick disease 1893 0.00111751261284901
nasopharyngeal carcinoma 1056 0.00122277349430725
ulcerative colitis 2087 0.00128801756828692
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00191582439277905
astrocytoma 1493 0.0023821771085753
nephrosclerosis 329 0.00532256954656269
gastric cancer 436 0.00592627324164758
active Crohn's disease 918 0.00823449795465809
dermatomyositis 967 0.0107667459926628
esophageal adenocarcinoma 737 0.0226209567392675
aldosterone-producing adenoma 664 0.0242449272670461
subependymal giant cell astrocytoma 2287 0.0327418161206317
Alzheimer's disease 644 0.0354060947341576
Disease Target Count Z-score Confidence
Cancer 2346 3.613 1.8
Heart disease 279 3.503 1.8
Acute endometritis 1 3.341 1.7


  Differential Expression (35)

Disease log2 FC p
nephrosclerosis -1.036 0.005
gastric cancer 1.100 0.006
malignant mesothelioma -3.500 0.000
astrocytoma -2.700 0.002
ependymoma -3.500 0.000
oligodendroglioma -2.400 0.000
esophageal adenocarcinoma 1.200 0.023
cutaneous lupus erythematosus 1.200 0.001
psoriasis -3.200 0.000
glioblastoma -3.200 0.000
osteosarcoma 3.859 0.000
medulloblastoma -3.100 0.000
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell 3.200 0.000
primitive neuroectodermal tumor -2.400 0.000
autosomal dominant Emery-Dreifuss muscul... 1.058 0.002
juvenile dermatomyositis 1.112 0.000
Atopic dermatitis 1.300 0.000
tuberculosis -1.200 0.000
non-small cell lung cancer -1.322 0.000
lung cancer -3.100 0.000
active Crohn's disease -1.229 0.008
interstitial cystitis 1.200 0.001
pediatric high grade glioma -2.900 0.000
pilocytic astrocytoma -2.800 0.000
aldosterone-producing adenoma -1.509 0.024
subependymal giant cell astrocytoma -2.236 0.033
nasopharyngeal carcinoma 1.600 0.001
lung carcinoma -1.400 0.000
Alzheimer's disease -1.400 0.035
Pick disease -2.500 0.001
ulcerative colitis -1.300 0.001
ovarian cancer -3.600 0.000
pituitary cancer 1.200 0.001
dermatomyositis 1.100 0.011


Accession O94925 Q9UL05 Q9UL06 Q9UL07 Q9UN40 GLS
Symbols GAC



PANTHER Protein Class (1)


3CZD   3UNW   3UO9   3VOY   3VOZ   3VP0   3VP1   3VP2   3VP3   3VP4   4O7D   5D3O   5FI2   5FI6   5FI7   5HL1   5I94   5JYO   5JYP  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 GO Function (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
624146 confirmatory 105 / 173 / 1002 qHTS for Inhibitors of Glutaminase (GLS): LOPAC Validation
624154 summary 0 / 0 / 0 qHTS for Inhibitors of Glutaminase (GLS): Summary
624170 confirmatory 846 / 6744 / 401810 qHTS for Inhibitors of Glutaminase (GLS)
624261 confirmatory 5 / 14 / 17 qHTS for Inhibitors of Glutaminase (GLS): Hit Confirmation

Gene RIF (50)

27089238 Findings indicate a role for transcription factor c-Jun as a driver of cancer cell metabolic reprogramming, and suggest that cancers overexpressing JUN may be especially sensitive to glutaminase (GLS)-targeted therapies.
26710269 GLS1 was identified as a potential downstream target of the miR-192/-204-HOTTIP axis in hepatocellular carcinoma.
26575584 Data suggest that glutaminase C (GAC) inhibition maybe a potential treatment strategy for acquired erlotinib-resistant non-small cell lung cancer (NSCLC).
26134042 In the present study it was determined whether three key enzymes for glycolysis, glutaminolysis and de novo synthesis of FAs, hexokinase-2, glutaminase and fatty acid synthase
25915584 studies demonstrate that GLS is required for tumorigenesis and support small molecule and genetic inhibition of GLS as potential approaches for targeting the tumor cell-autonomous dependence on GLS for cancer therapy.
25880019 Our findings support the role of the GLS long microsatellite in the development of HE; this could be important for identifying susceptible patients and for the prevention of this condition.
25482439 GLS1 has a key role in coupling glutaminolysis of the TCA cycle with elevated glucose uptake and consequently the growth of prostate cancer cells
25297978 GABAergic neurons and astrocytes express Gls and Gls2 isoenzymes in nucleus and mitochondria, in addition to glutamatergic neurons
24755074 The rate of Glu decarboxylation into GABA by Glnase is an order of magnitude lower than that of Glutamate decarboxylase. Potential impact on the mechanistic aspects of Gln-Glu shuttle in neuroscience and glutaminolysis in tumors, is discussed.
24696726 These results suggest that the expression of GLS1 is upregulated and correlates with clinicopathological factors in colorectal cancer.

AA Sequence

GHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL                                   631 - 669

Text Mined References (76)

PMID Year Title
27089238 2016 The oncogenic transcription factor c-Jun regulates glutaminase expression and sensitizes cells to glutaminase-targeted therapy.
26710269 2015 MiRNA-192 [corrected] and miRNA-204 Directly Suppress lncRNA HOTTIP and Interrupt GLS1-Mediated Glutaminolysis in Hepatocellular Carcinoma.
26575584 2016 Inhibition of mitochondrial glutaminase activity reverses acquired erlotinib resistance in non-small cell lung cancer.
26134042 2015 Antitumor effects of a drug combination targeting glycolysis, glutaminolysis and de novo synthesis of fatty acids.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25915584 2015 Targeted inhibition of tumor-specific glutaminase diminishes cell-autonomous tumorigenesis.
25880019 2015 A genetic variant in the promoter of phosphate-activated glutaminase is associated with hepatic encephalopathy.
25482439 2015 Elevated expression of glutaminase confers glucose utilization via glutaminolysis in prostate cancer.
25297978 2015 Expression of Gls and Gls2 glutaminase isoforms in astrocytes.
24755074 2014 Glutaminase catalyzes reaction of glutamate to GABA.