Property Summary

NCBI Gene PubMed Count 69
Grant Count 59
R01 Count 33
Funding $7,557,531.73
PubMed Score 716.88
PubTator Score 146.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (35)

Disease log2 FC p
nephrosclerosis -1.036 0.005
gastric cancer 1.100 0.006
malignant mesothelioma -3.500 0.000
astrocytoma -2.700 0.002
ependymoma -3.500 0.000
oligodendroglioma -2.400 0.000
esophageal adenocarcinoma 1.200 0.023
cutaneous lupus erythematosus 1.200 0.001
psoriasis -3.200 0.000
glioblastoma -3.200 0.000
osteosarcoma 3.859 0.000
medulloblastoma -3.100 0.000
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell 3.200 0.000
primitive neuroectodermal tumor -2.400 0.000
autosomal dominant Emery-Dreifuss muscul... 1.058 0.002
juvenile dermatomyositis 1.112 0.000
Atopic dermatitis 1.300 0.000
tuberculosis -1.200 0.000
non-small cell lung cancer -1.322 0.000
lung cancer -3.100 0.000
active Crohn's disease -1.229 0.008
interstitial cystitis 1.200 0.001
pediatric high grade glioma -2.900 0.000
pilocytic astrocytoma -2.800 0.000
aldosterone-producing adenoma -1.509 0.024
subependymal giant cell astrocytoma -2.236 0.033
nasopharyngeal carcinoma 1.600 0.001
lung carcinoma -1.400 0.000
Alzheimer's disease -1.400 0.035
Pick disease -2.500 0.001
ulcerative colitis -1.300 0.001
ovarian cancer -3.600 0.000
pituitary cancer 1.200 0.001
dermatomyositis 1.100 0.011

Synonym

Accession O94925 Q9UL05 Q9UL06 Q9UL07 Q9UN40 GLS
Symbols GAC
GAM
KGA
GLS1
AAD20

Gene

GLS

PANTHER Protein Class (1)

PDB

3CZD   3UNW   3UO9   3VOY   3VOZ   3VP0   3VP1   3VP2   3VP3   3VP4   4O7D   5D3O   5FI2   5FI6   5FI7   5HL1   5I94   5JYO   5JYP  

 GO Function (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
624146 confirmatory 105 / 173 / 1002 qHTS for Inhibitors of Glutaminase (GLS): LOPAC Validation
624154 summary 0 / 0 / 0 qHTS for Inhibitors of Glutaminase (GLS): Summary
624170 confirmatory 846 / 6744 / 401810 qHTS for Inhibitors of Glutaminase (GLS)
624261 confirmatory 5 / 14 / 17 qHTS for Inhibitors of Glutaminase (GLS): Hit Confirmation

Gene RIF (50)

PMID Text
27089238 Findings indicate a role for transcription factor c-Jun as a driver of cancer cell metabolic reprogramming, and suggest that cancers overexpressing JUN may be especially sensitive to glutaminase (GLS)-targeted therapies.
26710269 GLS1 was identified as a potential downstream target of the miR-192/-204-HOTTIP axis in hepatocellular carcinoma.
26575584 Data suggest that glutaminase C (GAC) inhibition maybe a potential treatment strategy for acquired erlotinib-resistant non-small cell lung cancer (NSCLC).
26134042 In the present study it was determined whether three key enzymes for glycolysis, glutaminolysis and de novo synthesis of FAs, hexokinase-2, glutaminase and fatty acid synthase
25915584 studies demonstrate that GLS is required for tumorigenesis and support small molecule and genetic inhibition of GLS as potential approaches for targeting the tumor cell-autonomous dependence on GLS for cancer therapy.
25880019 Our findings support the role of the GLS long microsatellite in the development of HE; this could be important for identifying susceptible patients and for the prevention of this condition.
25482439 GLS1 has a key role in coupling glutaminolysis of the TCA cycle with elevated glucose uptake and consequently the growth of prostate cancer cells
25297978 GABAergic neurons and astrocytes express Gls and Gls2 isoenzymes in nucleus and mitochondria, in addition to glutamatergic neurons
24755074 The rate of Glu decarboxylation into GABA by Glnase is an order of magnitude lower than that of Glutamate decarboxylase. Potential impact on the mechanistic aspects of Gln-Glu shuttle in neuroscience and glutaminolysis in tumors, is discussed.
24696726 These results suggest that the expression of GLS1 is upregulated and correlates with clinicopathological factors in colorectal cancer.
More...

AA Sequence

MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGGGGWPAEPLAR      1 - 70
GLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEGKELVASGENKIKQGLLPSLE     71 - 140
DLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVL    141 - 210
LTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKV    211 - 280
PFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVN    281 - 350
NAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI    351 - 420
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILL    421 - 490
VVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFA    491 - 560
AYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHF    561 - 630
GHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL                                   631 - 669
//

Text Mined References (76)

PMID Year Title
27089238 2016 The oncogenic transcription factor c-Jun regulates glutaminase expression and sensitizes cells to glutaminase-targeted therapy.
26710269 2015 MiRNA-192 [corrected] and miRNA-204 Directly Suppress lncRNA HOTTIP and Interrupt GLS1-Mediated Glutaminolysis in Hepatocellular Carcinoma.
26575584 2016 Inhibition of mitochondrial glutaminase activity reverses acquired erlotinib resistance in non-small cell lung cancer.
26134042 2015 Antitumor effects of a drug combination targeting glycolysis, glutaminolysis and de novo synthesis of fatty acids.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25915584 2015 Targeted inhibition of tumor-specific glutaminase diminishes cell-autonomous tumorigenesis.
25880019 2015 A genetic variant in the promoter of phosphate-activated glutaminase is associated with hepatic encephalopathy.
25482439 2015 Elevated expression of glutaminase confers glucose utilization via glutaminolysis in prostate cancer.
25297978 2015 Expression of Gls and Gls2 glutaminase isoforms in astrocytes.
24755074 2014 Glutaminase catalyzes reaction of glutamate to GABA.
More...