Property Summary

NCBI Gene PubMed Count 29
PubMed Score 953.00
PubTator Score 284.06

Knowledge Summary


No data available


  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 1.042 4.5e-02
adult high grade glioma -1.300 1.5e-02
atypical teratoid / rhabdoid tumor -1.200 4.6e-02
colon cancer -1.600 2.4e-02
cutaneous lupus erythematosus 2.000 2.3e-02
glioblastoma -1.400 1.7e-02
intraductal papillary-mucinous carcinoma... 3.100 1.1e-03
lung cancer 1.900 7.8e-04
lung carcinoma 2.600 1.1e-42
malignant mesothelioma 6.200 2.1e-09
medulloblastoma -1.100 3.6e-02
medulloblastoma, large-cell -2.800 2.4e-03
osteosarcoma -2.280 5.7e-07
posterior fossa group B ependymoma -1.200 3.9e-04
primary Sjogren syndrome 2.000 1.1e-04


Accession O94900 Q96AV5
Symbols TOX1



  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (16)

AA Sequence

EYVRSGCRNPPPQPVDWNNDYCSSGGMQRDKALYLT                                      491 - 526

Text Mined References (30)

PMID Year Title