Property Summary

NCBI Gene PubMed Count 26
PubMed Score 990.49
PubTator Score 284.06

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.07231785885884E-42
malignant mesothelioma 3163 2.05756867482156E-9
osteosarcoma 7933 5.74684640717789E-7
primary Sjogren syndrome 789 1.13272076406712E-4
posterior fossa group B ependymoma 1530 3.94731249816623E-4
colon cancer 1475 6.99672326806353E-4
lung cancer 4473 7.76495373600246E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00105397104332332
atypical teratoid / rhabdoid tumor 4369 0.00131648427839654
medulloblastoma, large-cell 6234 0.00239965487248523
adult high grade glioma 2148 0.0148493716556571
glioblastoma 5572 0.0166529330057648
cutaneous lupus erythematosus 1056 0.0227970250843879
medulloblastoma 1524 0.0361250520319179
active Crohn's disease 918 0.0449370779196834


  Differential Expression (15)


Accession O94900 Q96AV5
Symbols TOX1



  Ortholog (11)

Gene RIF (13)

26139146 Significant associations between single nucleotide polymorphisms in TOX, CDKN2A/B and type 2 diabetes meillitus.
26125895 The SLC2A9 (rs7660895) and TOX (rs11777927) gene polymorphisms may be associated with formation of intracranial aneurysms, and rs7660895 may be associated with intracranial aneurysms rupture.
25548321 High TOX transcript levels correlate with increased cutaneous T-cell lymphoma.
25216799 TOX may be a specific marker for tumour cells in some types of cutaneous lymphoma.
23415668 SNP rs2726600 is located in a transcription-factor binding site in the 3' region of TOX.
22496870 Compared with TOX4, expression of TOX1, TOX2 and TOX3 in normal lung was 25, 44, and 88%lower, respectively, supporting the premise that reduced promoter activity confers increased susceptibility to methylation during lung carcinogenesis.
21126536 results suggest that TOX is required for IL-15-mediated natural killer (NK) cell differentiation and affected expression of T-bet that plays critical roles in NK differentiation and maturation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

EYVRSGCRNPPPQPVDWNNDYCSSGGMQRDKALYLT                                      491 - 526

Text Mined References (27)

PMID Year Title
26139146 2015 TOX and CDKN2A/B Gene Polymorphisms Are Associated with Type 2 Diabetes in Han Chinese.
26125895 2015 Intracranial aneurysm risk factor genes: relationship with intracranial aneurysm risk in a Chinese Han population.
25548321 2015 Evidence of an oncogenic role of aberrant TOX activation in cutaneous T-cell lymphoma.
25367360 2015 Genome-wide association study for refractive astigmatism reveals genetic co-determination with spherical equivalent refractive error: the CREAM consortium.
25233373 2014 Genome-wide meta-analysis of myopia and hyperopia provides evidence for replication of 11 loci.
25216799 2014 TOX expression in different subtypes of cutaneous lymphoma.
23415668 2013 Age-dependent association between pulmonary tuberculosis and common TOX variants in the 8q12-13 linkage region.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22496870 2012 Differential epigenetic regulation of TOX subfamily high mobility group box genes in lung and breast cancers.