Property Summary

NCBI Gene PubMed Count 9
Grant Count 3
Funding $19,615.25
PubMed Score 15.59
PubTator Score 2.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
oligodendroglioma 1.200 0.017
psoriasis -1.200 0.004
osteosarcoma 1.523 0.000
medulloblastoma 1.600 0.000
astrocytoma 1.500 0.003
atypical teratoid / rhabdoid tumor 1.700 0.000
glioblastoma 1.300 0.003
medulloblastoma, large-cell 1.400 0.000
primitive neuroectodermal tumor 1.700 0.000
tuberculosis -1.200 0.000
pancreatic ductal adenocarcinoma liver m... 1.072 0.011
non-small cell lung cancer 1.274 0.000
sarcoidosis 1.100 0.010
Pick disease 1.700 0.000
ovarian cancer 2.200 0.000
pituitary cancer -1.100 0.001

Synonym

Accession O94888 D3DXB3 Q6ZP77 Q86X20 Q8N327
Symbols UBXD7

Gene

PDB

1WJ4   2DAL   2DLX  

Gene RIF (3)

PMID Text
22537386 Study finds that UBXN7 over-expression converts CUL2 to its neddylated form and causes the accumulation of non-ubiquitylated HIF1alpha.
21645854 FAF1 and UBXD7 only bind to p97-UFD1/NPL4, but not free p97, thus demonstrating for the first time a hierarchy in p97-cofactor interactions
18775313 UBXD7 links p97 to the ubiquitin ligase CUL2/VHL and its substrate hypoxia-inducible factor 1alpha (HIF1alpha).

AA Sequence

MAAHGGSAASSALKGLIQQFTTITGASESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPSTSSASVSTVR      1 - 70
PHTEEEVRAPIPQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIRQEQELRNGGAIDKKLTTLAD     71 - 140
LFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREHFIFWQVYHDS    141 - 210
EEGQRYIQFYKLGDFPYVSILDPRTGQKLVEWHQLDVSSFLDQVTGFLGEHGQLDGLSSSPPKKCARSES    211 - 280
LIDASEDSQLEAAIRASLQETHFDSTQTKQDSRSDEESESELFSGSEEFISVCGSDEEEEVENLAKSRKS    281 - 350
PHKDLGHRKEENRRPLTEPPVRTDPGTATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGPKAQLMLRYP    351 - 420
DGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQETVFVQERN     421 - 489
//

Text Mined References (20)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22537386 2012 UBXN7 docks on neddylated cullin complexes using its UIM motif and causes HIF1? accumulation.
21645854 2011 Hierarchical binding of cofactors to the AAA ATPase p97.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18775313 2008 UBXD7 binds multiple ubiquitin ligases and implicates p97 in HIF1alpha turnover.
More...