Property Summary

NCBI Gene PubMed Count 49
PubMed Score 119.24
PubTator Score 71.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Atopic dermatitis 1.200 2.5e-04
atypical teratoid / rhabdoid tumor -2.600 5.1e-06
Breast cancer -2.500 5.0e-08
breast carcinoma -1.100 1.9e-14
colon cancer -1.400 2.0e-02
cystic fibrosis 1.549 5.9e-06
ependymoma 1.300 4.1e-02
group 3 medulloblastoma -1.400 1.3e-02
interstitial lung disease 1.500 2.5e-02
intraductal papillary-mucinous adenoma (... -1.200 2.2e-03
intraductal papillary-mucinous carcinoma... -1.400 2.5e-03
intraductal papillary-mucinous neoplasm ... -1.800 3.3e-03
lung adenocarcinoma -1.133 6.2e-13
lung cancer -1.600 5.5e-04
lung carcinoma 1.800 5.4e-24
medulloblastoma, large-cell -2.400 3.8e-04
non-small cell lung cancer -1.362 1.1e-14
oligodendroglioma 1.400 1.7e-02
osteosarcoma -3.702 8.1e-05
ovarian cancer -1.200 2.1e-03
pediatric high grade glioma -1.200 1.1e-02
Pick disease -1.400 3.2e-03
psoriasis -3.400 1.7e-05

Gene RIF (20)

AA Sequence

MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPSIQNELTQPPTITKQSAKDHIVDPRDNILIECEAKGNPA      1 - 70
PSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSP     71 - 140
LWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQGHNGDLYFSNVMLQDMQTD    141 - 210
YSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAW    211 - 280
YKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAP    281 - 350
GEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLAN    351 - 420
AFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKM    421 - 490
IRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQLECRVKHDPSLKLTVSWLKD    491 - 560
DEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR    561 - 630
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQF    631 - 700
RVIAINEVGSSHPSLPSERYRTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRR    701 - 770
ETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYPRAAPTEVKVRVMNST    771 - 840
AISLQWNRVYSDTVQGQLREYRAYYWRESSLLKNLWVSQKRQQASFPGDRLRGVVSRLFPYSNYKLEMVV    841 - 910
VNGRGDGPRSETKEFTTPEGVPSAPRRFRVRQPNLETINLEWDHPEHPNGIMIGYTLKYVAFNGTKVGKQ    911 - 980
IVENFSPNQTKFTVQRTDPVSRYRFTLSARTQVGSGEAVTEESPAPPNEATPTAAPPTLPPTTVGATGAV    981 - 1050
SSTDATAIAATTEATTVPIIPTVAPTTIATTTTVATTTTTTAAATTTTESPPTTTSGTKIHESAPDEQSI   1051 - 1120
WNVTVLPNSKWANITWKHNFGPGTDFVVEYIDSNHTKKTVPVKAQAQPIQLTDLYPGMTYTLRVYSRDNE   1121 - 1190
GISSTVITFMTSTAYTNNQADIATQGWFIGLMCAIALLVLILLIVCFIKRSRGGKYPVREKKDVPLGPED   1191 - 1260
PKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEG   1261 - 1330
NESSEATSPVNAIYSLA                                                        1331 - 1347
//

Text Mined References (51)

PMID Year Title