Property Summary

NCBI Gene PubMed Count 47
Grant Count 75
R01 Count 68
Funding $6,267,941.92
PubMed Score 102.84
PubTator Score 71.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
interstitial lung disease 1.500 0.025
ependymoma 1.300 0.041
oligodendroglioma 1.400 0.017
psoriasis -3.400 0.000
osteosarcoma -3.702 0.000
group 4 medulloblastoma -2.300 0.000
cystic fibrosis 1.549 0.000
atypical teratoid/rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -2.400 0.000
Atopic dermatitis 1.200 0.000
non-small cell lung cancer -1.362 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.002
intraductal papillary-mucinous carcinoma... -1.400 0.003
intraductal papillary-mucinous neoplasm ... -1.800 0.003
lung cancer -1.600 0.001
colon cancer -1.400 0.020
pediatric high grade glioma -1.200 0.011
lung adenocarcinoma -1.133 0.000
lung carcinoma 1.800 0.000
breast carcinoma -1.100 0.000
Pick disease -1.400 0.003
Breast cancer -2.500 0.000
ovarian cancer -1.200 0.002

Gene

PDB

3P3Y   3P40  

Gene RIF (18)

PMID Text
26843559 -NF155 IgG4 antibodies were associated with a subgroup of patients with CIDP showing a younger age at onset, ataxia, tremor, CNS demyelination, and a poor response to IV immunoglobulin.
25672685 It is a common protein to the central and peripheral nervous system may play a pivotal role in combined demyelination in Combined central and peripheral demyelination.
24523485 Autoantibodies to NF155 identify a inflammatory demyelinating polyradiculoneuropathy subtype characterized by severe neuropathy, poor response to intravenous immunoglobulin, and disabling tremor.
23884033 Anti-neurofascin antibody is frequently present in patients with CCPD.
22913984 Three neuronal proteins (Huntingtin interacting protein 1, neurofascin, and olfactomedin-like 2a) are novel components of podocyte major processes and their expression in glomerular crescents supports their role in crescent formation.
22492029 Cerebellar pinceau organization requires coordinated mechanisms involving specific neurofascin functions in both Purkinje and basket neurons.
22462667 gliomedin, NF186, and contactin are novel target antigens in Guillain-Barre syndrome
22306302 Neurofascin isoforms of 186, 180, 166 and 155 kDa are generated by alternative splicing and provide a switch between neuronal plasticity and stability. (Review)
22009740 Fibronectin type III-like domains of neurofascin-186 protein mediate gliomedin binding and its clustering at the developing nodes of Ranvier
21047790 two crystal structures of a dimeric form of the headpiece of neurofascin
More...

AA Sequence

MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPSIQNELTQPPTITKQSAKDHIVDPRDNILIECEAKGNPA      1 - 70
PSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSP     71 - 140
LWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQGHNGDLYFSNVMLQDMQTD    141 - 210
YSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAW    211 - 280
YKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAP    281 - 350
GEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLAN    351 - 420
AFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKM    421 - 490
IRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQLECRVKHDPSLKLTVSWLKD    491 - 560
DEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR    561 - 630
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQF    631 - 700
RVIAINEVGSSHPSLPSERYRTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRR    701 - 770
ETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYPRAAPTEVKVRVMNST    771 - 840
AISLQWNRVYSDTVQGQLREYRAYYWRESSLLKNLWVSQKRQQASFPGDRLRGVVSRLFPYSNYKLEMVV    841 - 910
VNGRGDGPRSETKEFTTPEGVPSAPRRFRVRQPNLETINLEWDHPEHPNGIMIGYTLKYVAFNGTKVGKQ    911 - 980
IVENFSPNQTKFTVQRTDPVSRYRFTLSARTQVGSGEAVTEESPAPPNEATPTAAPPTLPPTTVGATGAV    981 - 1050
SSTDATAIAATTEATTVPIIPTVAPTTIATTTTVATTTTTTAAATTTTESPPTTTSGTKIHESAPDEQSI   1051 - 1120
WNVTVLPNSKWANITWKHNFGPGTDFVVEYIDSNHTKKTVPVKAQAQPIQLTDLYPGMTYTLRVYSRDNE   1121 - 1190
GISSTVITFMTSTAYTNNQADIATQGWFIGLMCAIALLVLILLIVCFIKRSRGGKYPVREKKDVPLGPED   1191 - 1260
PKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEG   1261 - 1330
NESSEATSPVNAIYSLA                                                        1331 - 1347
//

Text Mined References (49)

PMID Year Title
26843559 2016 Neurofascin-155 IgG4 in chronic inflammatory demyelinating polyneuropathy.
25672685 2014 [Neurofascin: a novel target for combined central and peripheral demyelination].
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24523485 2014 Neurofascin IgG4 antibodies in CIDP associate with disabling tremor and poor response to IVIg.
23897819 2013 Myocilin mediates myelination in the peripheral nervous system through ErbB2/3 signaling.
23884033 2013 Anti-neurofascin antibody in patients with combined central and peripheral demyelination.
23533358 2013 NCK2 is significantly associated with opiates addiction in African-origin men.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
More...