Property Summary

NCBI Gene PubMed Count 19
PubMed Score 22.15
PubTator Score 9.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Autistic Disorder 320
Refractive Errors 18
Disease Target Count P-value
ovarian cancer 8492 5.86470305989623E-11
malignant mesothelioma 3163 3.19752029434651E-8
ulcerative colitis 2087 2.5209366400516E-7
cystic fibrosis 1670 6.96605560025648E-7
nasopharyngeal carcinoma 1056 2.73071370971454E-4
lung adenocarcinoma 2714 3.00483625396917E-4
lung cancer 4473 0.00151586686858896
pilocytic astrocytoma 3086 0.00787296147929699
mucosa-associated lymphoid tissue lymphoma 480 0.00861070499523411
gastric carcinoma 832 0.0164278828176955
pediatric high grade glioma 2712 0.0182038125211155
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0253846582502252
Disease Target Count Z-score Confidence
Refractive error 43 0.0 2.0
Disease Target Count Z-score Confidence
Situs Inversus 52 4.079 2.0

Expression

  Differential Expression (12)

Synonym

Accession O94832 A6H8V3 Q8NHP9
Symbols myr4
PPP1R108

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (5)

PMID Text
25006744 Top single-nucleotide polymorphism rs379123 in MYO1D is located within genes that function in cell-cell signaling and cell migration.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
17376794 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKLLNIYGRDTIEQYKGRE      1 - 70
LYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLK     71 - 140
SNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQG    141 - 210
GSEQMLRSLHLQKSLSSYNYIHVGAQLKSSINDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNL    211 - 280
KFVVDGDTPLIENGKVVSIIAELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYER    281 - 350
LFCWIVTRINDIIEVKNYDTTIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQ    351 - 420
EEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLGKHAHFSSRKL    421 - 490
CASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLMYNSSNPVLKNMWPEGKLSITEVTKR    491 - 560
PLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQIFDDERCRHQVEYLGLLENVRVRRAGFAFRQ    561 - 630
TYEKFLHRYKMISEFTWPNHDLPSDKEAVKKLIERCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLIR    631 - 700
IVLFLQKVWRGTLARMRYKRTKAALTIIRYYRRYKVKSYIHEVARRFHGVKTMRDYGKHVKWPSPPKVLR    701 - 770
RFEEALQTIFNRWRASQLIKSIPASDLPQVRAKVAAVEMLKGQRADLGLQRAWEGNYLASKPDTPQTSGT    771 - 840
FVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKTIPLYNLTGLSVS    841 - 910
NGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSEKRHLQVNVTNPVQCSLHGKKCTVS    911 - 980
VETRLNQPQPDFTKNRSGFILSVPGN                                                981 - 1006
//

Text Mined References (21)

PMID Year Title
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22322875 2012 Genetic association of short sleep duration with hypertension incidence--a 6-year follow-up in the Korean genome and epidemiology study.
22284616 2012 Expression and localization of myosin-1d in the developing nervous system.
21269460 2011 Initial characterization of the human central proteome.
20686608 2010 Genome-wide association study of pancreatic cancer in Japanese population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...