Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.12
PubTator Score 9.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 8.5e-03
cystic fibrosis 2.530 7.0e-07
gastric carcinoma 1.300 1.6e-02
intraductal papillary-mucinous carcinoma... 1.300 2.5e-02
lung adenocarcinoma 1.207 3.0e-04
lung cancer 1.100 1.5e-03
malignant mesothelioma -3.400 3.2e-08
mucosa-associated lymphoid tissue lympho... 1.212 8.6e-03
nasopharyngeal carcinoma -1.200 2.7e-04
ovarian cancer -1.700 5.9e-11
pediatric high grade glioma -1.100 1.8e-02
ulcerative colitis -1.900 2.5e-07

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKLLNIYGRDTIEQYKGRE      1 - 70
LYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLK     71 - 140
SNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQG    141 - 210
GSEQMLRSLHLQKSLSSYNYIHVGAQLKSSINDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNL    211 - 280
KFVVDGDTPLIENGKVVSIIAELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYER    281 - 350
LFCWIVTRINDIIEVKNYDTTIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQ    351 - 420
EEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLGKHAHFSSRKL    421 - 490
CASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLMYNSSNPVLKNMWPEGKLSITEVTKR    491 - 560
PLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQIFDDERCRHQVEYLGLLENVRVRRAGFAFRQ    561 - 630
TYEKFLHRYKMISEFTWPNHDLPSDKEAVKKLIERCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLIR    631 - 700
IVLFLQKVWRGTLARMRYKRTKAALTIIRYYRRYKVKSYIHEVARRFHGVKTMRDYGKHVKWPSPPKVLR    701 - 770
RFEEALQTIFNRWRASQLIKSIPASDLPQVRAKVAAVEMLKGQRADLGLQRAWEGNYLASKPDTPQTSGT    771 - 840
FVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKTIPLYNLTGLSVS    841 - 910
NGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSEKRHLQVNVTNPVQCSLHGKKCTVS    911 - 980
VETRLNQPQPDFTKNRSGFILSVPGN                                                981 - 1006
//

Text Mined References (21)

PMID Year Title