Property Summary

NCBI Gene PubMed Count 25
PubMed Score 54.85
PubTator Score 22.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Synonym

Accession O94829 D3DPY4 Q5T4X3 Q7LC04 Q96HS3 Q9H8N3 Q9UFR1 Imp13
Symbols LGL2
IMP13
KAP13
RANBP13

Gene

PANTHER Protein Class (1)

PDB

2XWU   2X19   3ZJY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

AA Sequence

MERREEQPGAAGAGAAPALDFTVENVEKALHQLYYDPNIENKNLAQKWLMQAQVSPQAWHFSWQLLQPDK      1 - 70
VPEIQYFGASALHIKISRYWSDIPTDQYESLKAQLFTQITRFASGSKIVLTRLCVALASLALSMMPDAWP     71 - 140
CAVADMVRLFQAEDSPVDGQGRCLALLELLTVLPEEFQTSRLPQYRKGLVRTSLAVECGAVFPLLEQLLQ    141 - 210
QPSSPSCVRQKVLKCFSSWVQLEVPLQDCEALIQAAFAALQDSELFDSSVEAIVNAISQPDAQRYVNTLL    211 - 280
KLIPLVLGLQEQLRQAVQNGDMETSHGICRIAVALGENHSRALLDQVEHWQSFLALVNMIMFCTGIPGHY    281 - 350
PVNETTSSLTLTFWYTLQDDILSFEAEKQAVYQQVYRPVYFQLVDVLLHKAQFPSDEEYGFWSSDEKEQF    351 - 420
RIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTSSEEPYSWQHTEALLYGFQSIAETIDVNYSDVVPG    421 - 490
LIGLIPRISISNVQLADTVMFTIGALSEWLADHPVMINSVLPLVLHALGNPELSVSSVSTLKKICRECKY    491 - 560
DLPPYAANIVAVSQDVLMKQIHKTSQCMWLMQALGFLLSALQVEEILKNLHSLISPYIQQLEKLAEEIPN    561 - 630
PSNKLAIVHILGLLSNLFTTLDISHHEDDHEGPELRKLPVPQGPNPVVVVLQQVFQLIQKVLSKWLNDAQ    631 - 700
VVEAVCAIFEKSVKTLLDDFAPMVPQLCEMLGRMYSTIPQASALDLTRQLVHIFAHEPAHFPPIEALFLL    701 - 770
VTSVTLTLFQQGPRDHPDIVDSFMQLLAQALKRKPDLFLCERLDVKAVFQCAVLALKFPEAPTVKASCGF    771 - 840
FTELLPRCGEVESVGKVVQEDGRMLLIAVLEAIGGQASRSLMDCFADILFALNKHCFSLLSMWIKEALQP    841 - 910
PGFPSARLSPEQKDTFSQQILRERVNKRRVKEMVKEFTLLCRGLHGTDYTADY                     911 - 963
//

Text Mined References (29)

PMID Year Title