Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.23
PubTator Score 5.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.44751009013527E-29
psoriasis 6685 3.64920006476697E-24
ependymoma 2514 1.76078406682807E-11
atypical teratoid / rhabdoid tumor 4369 5.3857047695971E-7
ovarian cancer 8492 1.46114227292533E-6
pediatric high grade glioma 2712 4.24641008647734E-5
pilocytic astrocytoma 3086 6.44745874545093E-5
glioblastoma 5572 7.48734095372223E-5
medulloblastoma, large-cell 6234 1.25200040054388E-4
primitive neuroectodermal tumor 3031 0.00101924947759837
pituitary cancer 1972 0.0123237315678875
astrocytic glioma 2241 0.0144176958784465
oligodendroglioma 2849 0.024536677407717
medulloblastoma 1524 0.0246820257803468
Disease Target Count Z-score Confidence
Mental depression 58 0.0 1.0
Disease Target Count Z-score Confidence
Papilledema 5 3.54 1.8

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.600 0.014
ependymoma -2.900 0.000
oligodendroglioma -1.200 0.025
glioblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma -1.700 0.025
medulloblastoma, large-cell -3.700 0.000
primitive neuroectodermal tumor -2.700 0.001
pediatric high grade glioma -2.600 0.000
pilocytic astrocytoma -1.900 0.000
lung carcinoma 4.700 0.000
ovarian cancer -1.600 0.000
pituitary cancer 1.400 0.012
psoriasis -2.300 0.000

Synonym

Accession O94818 B4DSQ0 B7Z3Z7 F5H1E3 Q6IBS2 Q9BWF1
Symbols NOLP
CT125
HRIHFB2255

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
24337411 NOL4 was identified as a highly specific promoter methylated gene associated with head and neck squamous cell carcinoma
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MESERDMYRQFQDWCLRTYGDSGKTKTVTRKKYERIVQLLNGSESSSTDNAKFKFWVKSKGFQLGQPDEV      1 - 70
RGGGGGAKQVLYVPVKTTDGVGVDEKLSLRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAIS     71 - 140
ESYAFLPREAVTRFLMSCSECQKRMHLNPDGTDHKDNGKPPTLVTSMIDYNMPITMAYMKHMKLQLLNSQ    141 - 210
QDEDESSIESDEFDMSDSTRMSAVNSDLSSNLEERMQSPQNLHGQQDDDSAAESFNGNETLGHSSIASGG    211 - 280
THSREMGDSNSDGKTGLEQDEQPLNLSDSPLSAQLTSEYRIDDHNSNGKNKYKNLLISDLKMEREARENG    281 - 350
SKSPAHSYSSYDSGKNESVDRGAEDLSLNRGDEDEDDHEDHDDSEKVNETDGVEAERLKAFNMFVRLFVD    351 - 420
ENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQERARKRIRTYLKSCRRMKRSGFEMSRPIPSHLTSAVAE    421 - 490
SILASACESESRNAAKRMRLERQQDESAPADKQCKPEATQATYSTSAVPGSQDVLYINGNGTYSYHSYRG    491 - 560
LGGGLLNLNDASSSGPTDLSMKRQLATSSGSSSSSNSRPQLSPTEINAVRQLVAGYRESAAFLLRSADEL    561 - 630
ENLILQQN                                                                  631 - 638
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24337411 2014 Validation of nucleolar protein 4 as a novel methylated tumor suppressor gene in head and neck cancer.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19846067 2010 A genomewide association study of citalopram response in major depressive disorder.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...