Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.23
PubTator Score 5.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.600 0.014
ependymoma -2.900 0.000
oligodendroglioma -1.200 0.025
glioblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma -1.700 0.025
medulloblastoma, large-cell -3.700 0.000
primitive neuroectodermal tumor -2.700 0.001
pediatric high grade glioma -2.600 0.000
pilocytic astrocytoma -1.900 0.000
lung carcinoma 4.700 0.000
ovarian cancer -1.600 0.000
pituitary cancer 1.400 0.012
psoriasis -2.300 0.000

Gene RIF (2)

PMID Text
24337411 NOL4 was identified as a highly specific promoter methylated gene associated with head and neck squamous cell carcinoma
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MESERDMYRQFQDWCLRTYGDSGKTKTVTRKKYERIVQLLNGSESSSTDNAKFKFWVKSKGFQLGQPDEV      1 - 70
RGGGGGAKQVLYVPVKTTDGVGVDEKLSLRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAIS     71 - 140
ESYAFLPREAVTRFLMSCSECQKRMHLNPDGTDHKDNGKPPTLVTSMIDYNMPITMAYMKHMKLQLLNSQ    141 - 210
QDEDESSIESDEFDMSDSTRMSAVNSDLSSNLEERMQSPQNLHGQQDDDSAAESFNGNETLGHSSIASGG    211 - 280
THSREMGDSNSDGKTGLEQDEQPLNLSDSPLSAQLTSEYRIDDHNSNGKNKYKNLLISDLKMEREARENG    281 - 350
SKSPAHSYSSYDSGKNESVDRGAEDLSLNRGDEDEDDHEDHDDSEKVNETDGVEAERLKAFNMFVRLFVD    351 - 420
ENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQERARKRIRTYLKSCRRMKRSGFEMSRPIPSHLTSAVAE    421 - 490
SILASACESESRNAAKRMRLERQQDESAPADKQCKPEATQATYSTSAVPGSQDVLYINGNGTYSYHSYRG    491 - 560
LGGGLLNLNDASSSGPTDLSMKRQLATSSGSSSSSNSRPQLSPTEINAVRQLVAGYRESAAFLLRSADEL    561 - 630
ENLILQQN                                                                  631 - 638
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24337411 2014 Validation of nucleolar protein 4 as a novel methylated tumor suppressor gene in head and neck cancer.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19846067 2010 A genomewide association study of citalopram response in major depressive disorder.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...