Property Summary

NCBI Gene PubMed Count 17
Grant Count 31
R01 Count 28
Funding $2,328,691.05
PubMed Score 43.29
PubTator Score 9.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
ependymoma -1.500 0.000
glioblastoma -1.600 0.000
group 4 medulloblastoma -2.600 0.000
atypical teratoid/rhabdoid tumor -1.500 0.001
medulloblastoma, large-cell -2.500 0.002
active Crohn's disease -1.352 0.006
adult high grade glioma -2.100 0.000
pilocytic astrocytoma -1.100 0.004
lung carcinoma 1.600 0.000
Pick disease -1.900 0.000
progressive supranuclear palsy -1.300 0.029
Breast cancer 1.500 0.000

Gene RIF (5)

PMID Text
24828608 In granulosa cells, there are significant changes in expression during follicular maturation.
20627871 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
19497306 the successful purification of functionally intact Gbeta5-free recombinant RGS11 was reported that differentially interact with R7BP and Galpha(oa).
19460752 Knockdown of regulator of G-protein signaling 11 (RGS11) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MAAGPAPPPGRPRAQMPHLRKMERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEE      1 - 70
EALHLGAVLVQHGYIYPLRDPRSLMLRPDETPYRFQTPYFWTSTLRPAAELDYAIYLAKKNIRKRGTLVD     71 - 140
YEKDCYDRLHKKINHAWDLVLMQAREQLRAAKQRSKGDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRG    141 - 210
SCAASRVLMTKSADFHKREIEYFRKALGRTRVKSSVCLEAYLSFCGQRGPHDPLVSGCLPSNPWISDNDA    211 - 280
YWVMNAPTVAAPTKLRVERWGFSFRELLEDPVGRAHFMDFLGKEFSGENLSFWEACEELRYGAQAQVPTL    281 - 350
VDAVYEQFLAPGAAHWVNIDSRTMEQTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAE    351 - 420
AGIPLEMKRRVFPFTWRPRHSSPSPALLPTPVEPTAACGPGGGDGVA                           421 - 467
//

Text Mined References (17)

PMID Year Title
24828608 2014 Differential expression of poliovirus receptor, regulator of G-protein signaling 11 and erythrocyte protein band 4.1-like 3 in human granulosa cells during follicular growth and maturation.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19497306 2009 RGS11 interacts preferentially with R7BP over Galpha(oa)--characterization of Gbeta5-free RGS11.
18468998 2008 Blood pressure is regulated by an alpha1D-adrenergic receptor/dystrophin signalosome.
17568003 2007 Structured RNAs in the ENCODE selected regions of the human genome.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12606627 2003 Direct interactions between the heterotrimeric G protein subunit G beta 5 and the G protein gamma subunit-like domain-containing regulator of G protein signaling 11: gain of function of cyan fluorescent protein-tagged G gamma 3.
More...