Property Summary

NCBI Gene PubMed Count 17
PubMed Score 43.29
PubTator Score 9.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 8.09607346804106E-24
malignant mesothelioma 3163 2.87985512534356E-6
Pick disease 1893 1.55129230263651E-5
group 4 medulloblastoma 1875 1.70761528987975E-5
Breast cancer 3099 2.68992728789086E-5
ependymoma 2514 1.41046748278653E-4
glioblastoma 5572 3.13933284290462E-4
adult high grade glioma 2148 4.79311896067991E-4
atypical teratoid/rhabdoid tumor 1095 7.37330836426075E-4
medulloblastoma, large-cell 6234 0.0016868173762603
pilocytic astrocytoma 3086 0.00368208197848092
active Crohn's disease 918 0.0059812559935352
progressive supranuclear palsy 674 0.0291074996123809
Disease Target Count Z-score Confidence
Night Blindness 39 4.532 2.3
Japanese encephalitis 6 3.465 1.7
Retinoschisis 8 3.449 1.7

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
ependymoma -1.500 0.000
glioblastoma -1.600 0.000
group 4 medulloblastoma -2.600 0.000
atypical teratoid/rhabdoid tumor -1.500 0.001
medulloblastoma, large-cell -2.500 0.002
active Crohn's disease -1.352 0.006
adult high grade glioma -2.100 0.000
pilocytic astrocytoma -1.100 0.004
lung carcinoma 1.600 0.000
Pick disease -1.900 0.000
progressive supranuclear palsy -1.300 0.029
Breast cancer 1.500 0.000

Synonym

Accession O94810 O75883 Q4TT71 Q4TT72 RGS11
Symbols RS11

Gene

PANTHER Protein Class (2)

  Ortholog (6)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

Gene RIF (5)

PMID Text
24828608 In granulosa cells, there are significant changes in expression during follicular maturation.
20627871 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
19497306 the successful purification of functionally intact Gbeta5-free recombinant RGS11 was reported that differentially interact with R7BP and Galpha(oa).
19460752 Knockdown of regulator of G-protein signaling 11 (RGS11) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MAAGPAPPPGRPRAQMPHLRKMERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEE      1 - 70
EALHLGAVLVQHGYIYPLRDPRSLMLRPDETPYRFQTPYFWTSTLRPAAELDYAIYLAKKNIRKRGTLVD     71 - 140
YEKDCYDRLHKKINHAWDLVLMQAREQLRAAKQRSKGDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRG    141 - 210
SCAASRVLMTKSADFHKREIEYFRKALGRTRVKSSVCLEAYLSFCGQRGPHDPLVSGCLPSNPWISDNDA    211 - 280
YWVMNAPTVAAPTKLRVERWGFSFRELLEDPVGRAHFMDFLGKEFSGENLSFWEACEELRYGAQAQVPTL    281 - 350
VDAVYEQFLAPGAAHWVNIDSRTMEQTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAE    351 - 420
AGIPLEMKRRVFPFTWRPRHSSPSPALLPTPVEPTAACGPGGGDGVA                           421 - 467
//

Text Mined References (17)

PMID Year Title
24828608 2014 Differential expression of poliovirus receptor, regulator of G-protein signaling 11 and erythrocyte protein band 4.1-like 3 in human granulosa cells during follicular growth and maturation.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19497306 2009 RGS11 interacts preferentially with R7BP over Galpha(oa)--characterization of Gbeta5-free RGS11.
18468998 2008 Blood pressure is regulated by an alpha1D-adrenergic receptor/dystrophin signalosome.
17568003 2007 Structured RNAs in the ENCODE selected regions of the human genome.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12606627 2003 Direct interactions between the heterotrimeric G protein subunit G beta 5 and the G protein gamma subunit-like domain-containing regulator of G protein signaling 11: gain of function of cyan fluorescent protein-tagged G gamma 3.
More...