Property Summary

NCBI Gene PubMed Count 13
PubMed Score 450.43
PubTator Score 5.61

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O94808 Q53XM2 Q9BWS4
Symbols GFAT
GFAT2
GFAT 2

Gene

PANTHER Protein Class (2)

 GWAS Trait (1)

Gene RIF (5)

PMID Text
20353610 association of nine single nucleotide polymorphisms in ADPRT1, AKR1B1), RAGE, GFPT2 and PAI-1 genes with chronic renal insufficiency among Asian Indians with type 2 diabetes
20353610 Observational study of gene-disease association. (HuGE Navigator)
17574229 Increased GFAT activity appears to be associated with insulin resistance, postprandial hyperglycaemia and oxidative stress in T2DM and may point towards a potential pathway amenable for therapeutic intervention.
14764791 Observational study of gene-disease association. (HuGE Navigator)
14764791 GFPT2 mRNA levels in transformed lymphocytes significantly increased among African-Americans. Associated allele of 3' UTR SNP approximately 2-fold overexpressed. 3' UTR variant results in increased GFPT2 mRNA with resultant increased hexosamine flux.

AA Sequence

MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNHEVKERHIQLVKKRGKVKALDEEL      1 - 70
YKQDSMDLKVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHNGIITNYKDLRKFLESKGYEF     71 - 140
ESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFALVFKSVHYPGEAVATRRGSPLLIGVRS    141 - 210
KYKLSTEQIPILYRTCTLENVKNICKTRMKRLDSSACLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDD    211 - 280
DIAAVADGKLSIHRVKRSASDDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETN    281 - 350
TVLLGGLKDHLKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF    351 - 420
ISQSGETADTLLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFISLVMFG    421 - 490
LMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLEEKIHDLALELYTQRSLLVMGRGYNYATCLEGALKI    491 - 560
KEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCFAKCQNALQQVTARQGRPIILCSKDDTESSK    561 - 630
FAYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLRGYDVDFPRNLAKSVTVE                      631 - 682
//

Text Mined References (16)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21897333 2011 Genes linked to energy metabolism and immunoregulatory mechanisms are associated with subcutaneous adipose tissue distribution in HIV-infected men.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20353610 2010 Association analysis of ADPRT1, AKR1B1, RAGE, GFPT2 and PAI-1 gene polymorphisms with chronic renal insufficiency among Asian Indians with type-2 diabetes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17574229 2007 Glutamine fructose-6-phosphate amidotransferase (GFAT) gene expression and activity in patients with type 2 diabetes: inter-relationships with hyperglycaemia and oxidative stress.
17542649 2007 Mutations in gfpt1 and skiv2l2 cause distinct stage-specific defects in larval melanocyte regeneration in zebrafish.
More...