Property Summary

NCBI Gene PubMed Count 43
PubMed Score 84.65
PubTator Score 49.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 5.100 3.9e-08
ependymoma -1.100 5.2e-03
group 3 medulloblastoma -1.100 8.8e-03
intraductal papillary-mucinous adenoma (... -1.200 2.7e-02
non-small cell lung cancer -1.314 5.6e-19
oligodendroglioma -1.100 2.2e-03
ovarian cancer 2.400 1.8e-04
type II diabetes mellitus and post-ische... -1.500 8.4e-03

 GWAS Trait (1)

Gene RIF (22)

AA Sequence

MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLG      1 - 70
RRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTA     71 - 140
LMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA       141 - 207
//

Text Mined References (44)

PMID Year Title