Property Summary

NCBI Gene PubMed Count 38
PubMed Score 76.60
PubTator Score 49.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 3.51886998634793E-20
malignant mesothelioma 3163 3.88214455853509E-8
ovarian cancer 8492 1.79309221019286E-4
oligodendroglioma 2849 0.00219447445063202
ependymoma 2514 0.00517657898613436
type II diabetes mellitus and post-ischemic heart failure 89 0.00844464485443834
group 3 medulloblastoma 2254 0.00878671337848693
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0270219642901054
Disease Target Count Z-score Confidence
Osteoarthritis 96 3.341 1.7
Achondroplasia 20 3.155 1.6
Craniosynostosis 47 3.009 1.5

Expression

  Differential Expression (8)

Synonym

Accession O76093 D3DQL7 Q6UWF1 FGF-18
Symbols ZFGF5
FGF-18

Gene

PANTHER Protein Class (2)

PDB

4CJM  

  Ortholog (6)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (18)

PMID Text
24668462 The position of sulfate ions bound to FGF18 provides insight into the putative HS-binding site and allows comparison with the prototypical FGFs, FGF1, and FGF2.
24577103 Fgf18 as a molecule that protects articular cartilage by gene expression profiling, and the anticatabolic effects may at least partially be mediated by the Timp1 expression.
24018557 Tumors from ovarian cancer patients had increased FGF18 expression levels with microvessel density and M2 macrophage infiltration.
23397188 role for FGF-18 in chondrogenic and osteogenic events which drive discal development and ossification of the vertebral bodies.
21319186 FGF8, FGF17, and FGF18 are involved in autocrine and paracrine signaling in HCC and enhance the survival of tumor cells under stress conditions, malignant behavior, and neoangiogenesis.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20507176 FGF2 and -18 bind to discrete structures on the heparan sulfate chains attached to chondrocyte-derived perlecan which modulate the growth factor activities
19909293 fibroblast growth factor 18 seems to play a role in maintenance of chondrocyte properties, although its expression was rather high in dedifferentiated chondrocytes.
19727229 There was an association between gene FGF18 rs4043716 and nonsyndromic cleft lip with or without palate in Chinese population.
19727229 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLG      1 - 70
RRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTA     71 - 140
LMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA       141 - 207
//

Text Mined References (39)

PMID Year Title
24668462 2014 The crystal structure of fibroblast growth factor 18 (FGF18).
24577103 2014 Identification of fibroblast growth factor-18 as a molecule to protect adult articular cartilage by gene expression profiling.
24018557 2013 FGF18 as a prognostic and therapeutic biomarker in ovarian cancer.
23397188 2013 Comparative immunolocalisation of perlecan, heparan sulphate, fibroblast growth factor-18, and fibroblast growth factor receptor-3 and their prospective roles in chondrogenic and osteogenic development of the human foetal spine.
21319186 2011 Up-regulation of the fibroblast growth factor 8 subfamily in human hepatocellular carcinoma for cell survival and neoangiogenesis.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20507176 2010 Heparan sulfate-dependent signaling of fibroblast growth factor 18 by chondrocyte-derived perlecan.
20094046 2010 Fibroblast growth factor signalling: from development to cancer.
19909293 2010 Involvement of fibroblast growth factor 18 in dedifferentiation of cultured human chondrocytes.
19727229 2009 Correlation of the SNPs of FGFR1, FGF10, FGF18 with nonsyndromic cleft lip with or without palate in Chinese population.
More...