Property Summary

NCBI Gene PubMed Count 1
PubMed Score 84.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Umbilical hernia 18 3.176 1.6

Synonym

Accession O76087 B7ZM13 Q4V324 GAGE-7
Symbols AL4
CT4.7
GAGE-12G

Gene

 Compartment GO Term (0)

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGP      1 - 70
KPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC                            71 - 117
//

Text Mined References (6)

PMID Year Title
18179644 2008 An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10397259 1999 Characterization of the GAGE genes that are expressed in various human cancers and in normal testis.
9651357 1998 Isolation and characterization of PAGE-1 and GAGE-7. New genes expressed in the LNCaP prostate cancer progression model that share homology with melanoma-associated antigens.