Property Summary

NCBI Gene PubMed Count 4
PubMed Score 88.36

Knowledge Summary

Patent

No data available

Synonym

Accession O76087 B7ZM13 Q4V324 GAGE-7
Symbols GAGE-12B

Gene

 Compartment GO Term (1)

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGP      1 - 70
KPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC                            71 - 117
//

Text Mined References (8)

PMID Year Title