Property Summary

NCBI Gene PubMed Count 18
Grant Count 10
R01 Count 10
Funding $599,959.59
PubMed Score 24.19
PubTator Score 15.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.100 0.000
lung cancer 1.400 0.000

Gene RIF (3)

PMID Text
24245804 These data suggest that viperin requires CIAO1 for [4Fe-4S] cluster assembly, and acts through an enzymatic, Fe-S cluster- and SAM-dependent mechanism to inhibit viral RNA synthesis.
23891004 CIA2B-CIA1-MMS19 and CIA2A-CIA1 assist different branches of Fe/S protein assembly and intimately link this process to cellular iron regulation via IRP1 Fe/S cluster maturation and IRP2 stabilization.
22190034 HIV-1 IN is identified to have a physical interaction with cytosolic iron-sulfur protein assembly 1 (CIAO1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWS      1 - 70
PCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEY     71 - 140
ECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLA    141 - 210
SCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQ    211 - 280
EDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL               281 - 339
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24245804 2014 Viperin is an iron-sulfur protein that inhibits genome synthesis of tick-borne encephalitis virus via radical SAM domain activity.
23891004 2013 Human CIA2A-FAM96A and CIA2B-FAM96B integrate iron homeostasis and maturation of different subsets of cytosolic-nuclear iron-sulfur proteins.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22683786 2012 The mammalian DUF59 protein Fam96a forms two distinct types of domain-swapped dimer.
22678362 2012 MMS19 assembles iron-sulfur proteins required for DNA metabolism and genomic integrity.
22678361 2012 MMS19 links cytoplasmic iron-sulfur cluster assembly to DNA metabolism.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21468892 2011 Structure and function of WD40 domain proteins.
More...