Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
Funding $80,660
PubMed Score 8.26
PubTator Score 29.77

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -5.300 0.000
cystic fibrosis 2.685 0.000
Atopic dermatitis -1.600 0.012
Hydrolethalus syndrome 3.896 0.022

Synonym

Accession O76011 Q8IUT8 Q8N4W2
Symbols HA4
Ha-4
hHa4
KRTHA4

Gene

 Grant Application (2)

Gene RIF (2)

PMID Text
22790218 CK34betaE12 expression is a good indicator of lymph node metastasis, depth of tumor invasion, and differentiation in case of Esophageal squamous cell carcinoma (ESCC).
16286979 Overexpressed in recurrent superficial urothelial carcinoma.

AA Sequence

MLYAKPPPTINGIKGLQRKERLKPAHIHLQQLTCFSITCSSTMSYSCCLPSLGCRTSCSSRPCVPPSCHG      1 - 70
YTLPGACNIPANVSNCNWFCEGSFNGSEKETMQFLNDRLASYLEKVRQLERDNAELEKLIQERSQQQEPL     71 - 140
LCPSYQSYFKTIEELQQKILCAKAENARLVVNIDNAKLASDDFRSKYQTEQSLRLLVESDINSIRRILDE    141 - 210
LTLCKSDLESQVESLREELICLKKNHEEEVNTLRSQLGDRLNVEVDTAPTVDLNQVLNETRSQYEALVEI    211 - 280
NRREVEQWFATQTEELNKQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHNLRDSLENTLTESEAHYS    281 - 350
SQLSQVQSLITNVESQLAEIRCDLERQNQEYQVLLDVRARLECEINTYRSLLESEDCKLPCNPCATTNAS    351 - 420
GNSCGPCGTSQKGCCN                                                          421 - 436
//

Text Mined References (12)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22790218 2012 Expression of cytokeratin 34?E12 is a good indicator of tumor progression in esophageal squamous cell carcinoma.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16831889 2006 New consensus nomenclature for mammalian keratins.
16286979 2005 Cytokeratin 20, 34betaE12 and overexpression of HER-2/neu in urine cytology as predictors of recurrences in superficial urothelial carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10391933 1999 The catalog of human hair keratins. I. Expression of the nine type I members in the hair follicle.
9756910 1998 Characterization of a 190-kilobase pair domain of human type I hair keratin genes.
More...