Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.26
PubTator Score 29.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 2.1e-09
cystic fibrosis 1696 1.5e-07
Atopic dermatitis 952 1.2e-02
Hydrolethalus syndrome 128 2.2e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Atopic dermatitis -1.600 1.2e-02
cystic fibrosis 2.685 1.5e-07
Hydrolethalus syndrome 3.896 2.2e-02
malignant mesothelioma -5.300 2.1e-09

Synonym

Accession O76011 Q8IUT8 Q8N4W2
Symbols HA4
Ha-4
hHa4
KRTHA4

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (4)

AA Sequence

MLYAKPPPTINGIKGLQRKERLKPAHIHLQQLTCFSITCSSTMSYSCCLPSLGCRTSCSSRPCVPPSCHG      1 - 70
YTLPGACNIPANVSNCNWFCEGSFNGSEKETMQFLNDRLASYLEKVRQLERDNAELEKLIQERSQQQEPL     71 - 140
LCPSYQSYFKTIEELQQKILCAKAENARLVVNIDNAKLASDDFRSKYQTEQSLRLLVESDINSIRRILDE    141 - 210
LTLCKSDLESQVESLREELICLKKNHEEEVNTLRSQLGDRLNVEVDTAPTVDLNQVLNETRSQYEALVEI    211 - 280
NRREVEQWFATQTEELNKQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHNLRDSLENTLTESEAHYS    281 - 350
SQLSQVQSLITNVESQLAEIRCDLERQNQEYQVLLDVRARLECEINTYRSLLESEDCKLPCNPCATTNAS    351 - 420
GNSCGPCGTSQKGCCN                                                          421 - 436
//

Text Mined References (14)

PMID Year Title