Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.09
PubTator Score 47.03

Knowledge Summary

Patent (236)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03
non diabetic and post-ischemic heart failure 200 1.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Gene RIF (3)

AA Sequence

MNDDGKVNASSEGYFILVGFSNWPHLEVVIFVVVLIFYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLS      1 - 70
FLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTTECVLLVVMSYDRYAAVCRPLHYTVLMH     71 - 140
PRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFV    141 - 210
LIPLILILTSYGAIVRAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMCIYLQPPSGNSQDQGKFIALF    211 - 280
YTVVTPSLNPLIYTLRNKVVRGAVKRLMGWE                                           281 - 311
//

Text Mined References (14)

PMID Year Title