Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.10
PubTator Score 47.03

Knowledge Summary

Patent (236)

TINX Plot

  Disease Sources (2)

Disease Target Count
C3HEX, ABILITY TO SMELL 1
Disease Target Count P-value
diabetes mellitus 1663 0.00106283354735609
non diabetic and post-ischemic heart failure 200 0.00182088609842034

Synonym

Accession O76001 B0UY52 B9EH11 Q5SUJ7 Q6IF25 Q96R15 Q9GZK5 Q9GZL4 Q9GZL5
Symbols 6M1-3
OR6-6
C3HEXS
OR6-16
ORL671
HS6M1-3
OR6.3.6

Gene

  Ortholog (2)

Species Source
Macaque OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (2)

PMID Text
22714804 Two amino acid substitutions, T113A and R226Q, impaired the ability of OR2J3 to respond to cis-3-hexen-1-ol, and together these two substitutions effectively abolished the response to the compound.
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNDDGKVNASSEGYFILVGFSNWPHLEVVIFVVVLIFYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLS      1 - 70
FLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTTECVLLVVMSYDRYAAVCRPLHYTVLMH     71 - 140
PRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFV    141 - 210
LIPLILILTSYGAIVRAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMCIYLQPPSGNSQDQGKFIALF    211 - 280
YTVVTPSLNPLIYTLRNKVVRGAVKRLMGWE                                           281 - 311
//

Text Mined References (13)

PMID Year Title
24047820 2013 Common variation contributes to the genetic architecture of social communication traits.
23656994 2013 Functional genomics reveals dysregulation of cortical olfactory receptors in Parkinson disease: novel putative chemoreceptors in the human brain.
22714804 2012 Genetic variation in the odorant receptor OR2J3 is associated with the ability to detect the "grassy" smelling odor, cis-3-hexen-1-ol.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12637542 2003 Complex transcription and splicing of odorant receptor genes.
More...