Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.75
PubTator Score 1.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 5.0e-07
ovarian cancer 8520 1.7e-04
Multiple myeloma 1332 1.4e-03
astrocytic glioma 2597 2.0e-02
oligodendroglioma 2850 2.1e-02
ependymoma 4679 3.6e-02

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.200 2.0e-02
ependymoma -1.400 3.6e-02
malignant mesothelioma 1.300 5.0e-07
Multiple myeloma 1.702 1.4e-03
oligodendroglioma -1.400 2.1e-02
ovarian cancer 1.200 1.7e-04

AA Sequence

MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSHDMLVHVDNEAS      1 - 70
INQTTLELSTKSHVTEEEEEEEEEESDS                                               71 - 98
//

Text Mined References (16)

PMID Year Title