Property Summary

NCBI Gene PubMed Count 109
PubMed Score 76.17
PubTator Score 87.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 2.3e-03
atypical teratoid / rhabdoid tumor -1.200 7.0e-05
Breast cancer -1.500 1.1e-16
glioblastoma -1.200 4.3e-04
intraductal papillary-mucinous neoplasm ... 1.100 1.2e-02
lung cancer -1.400 1.9e-02
medulloblastoma, large-cell -1.100 3.4e-03
non-small cell lung cancer -1.327 1.8e-20
osteosarcoma -2.087 2.7e-05
ovarian cancer -1.700 9.5e-10
Rheumatoid arthritis 1.200 1.9e-02

Gene RIF (58)

AA Sequence

MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRFPQKIM      1 - 70
TPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQK     71 - 140
LPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCP    141 - 210
QEDHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSM    211 - 280
AVYLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALT    281 - 350
CSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK    351 - 420
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPL    421 - 490
NNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSL    491 - 560
LAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVT    561 - 630
NRSSTDTASIFGIIPDIISLD                                                     631 - 651
//

Text Mined References (125)

PMID Year Title