Property Summary

NCBI Gene PubMed Count 101
Grant Count 87
R01 Count 65
Funding $7,274,610.78
PubMed Score 70.45
PubTator Score 87.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.019
osteosarcoma -2.087 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.700 0.000
medulloblastoma, large-cell -1.100 0.003
non-small cell lung cancer -1.327 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.012
lung cancer -1.400 0.019
adult high grade glioma -1.100 0.002
Breast cancer -1.500 0.000
ovarian cancer -1.700 0.000

Synonym

Accession O75925 B2RB67 B3KSY9 C5J4B4 Q147X4 Q99751 Q9UN02
Symbols GBP
ZMIZ3
DDXBP1
GU/RH-II

Gene

PANTHER Protein Class (1)

PDB

1V66  

Gene RIF (52)

PMID Text
27032383 PIAS1 enhances p300 recruitment to c-Myb-bound sites through interaction with both proteins. In addition, the E3 activity of PIAS1 enhances further its coactivation
26450775 Data demonstrate that PIAS1 interacts with TRF2 and mediates its sumoylation serving as a molecular switch that controls the level of TRF2 at telomeres.
26403403 the expression of SENP8, SAE1, PIAS1, PIAS2 and ZMIZ1 is deregulated in the majority of PTC tissues, likely contributing to the PTC phenotype.
26219822 Results show that apocrine breast cancer and prostate cancer cells share a core AR cistrome and target gene signature linked to cancer cell growth, and PIAS1 plays a similar coregulatory role for AR in both cancer cell types.
25895136 c-Myc is targeted to the proteasome for degradation in a SUMOylation-dependent manner, regulated by PIAS1, SENP7 and RNF4
25474038 the presented data indicate that PIAS1 is crucial for parental and docetaxel resistant prostate cancer cell survival
24911587 Our data suggest that necdin suppresses PIAS1 both by inhibiting SUMO E3 ligase activity and by promoting ubiquitin-dependent degradation.
24872413 PIAS1 is the E3 ligase responsible for SUMOylation of HMGN2.
24586797 Elevated PIAS1 expression was observed in breast tumor samples.
24174529 Phosphorylation of serine residues adjacent to the PIAS1 SUMO-interacting motif favors formation of the non covalent PIAS1.SUMO.UBC9 ternary complex
More...

AA Sequence

MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRFPQKIM      1 - 70
TPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQK     71 - 140
LPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCP    141 - 210
QEDHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSM    211 - 280
AVYLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALT    281 - 350
CSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK    351 - 420
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPL    421 - 490
NNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSL    491 - 560
LAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVT    561 - 630
NRSSTDTASIFGIIPDIISLD                                                     631 - 651
//

Text Mined References (116)

PMID Year Title
27032383 2016 PIAS1 binds p300 and behaves as a coactivator or corepressor of the transcription factor c-Myb dependent on SUMO-status.
26450775 2015 PIAS1-mediated sumoylation promotes STUbL-dependent proteasomal degradation of the human telomeric protein TRF2.
26403403 PAPILLARY THYROID CANCER IS CHARACTERIZED BY ALTERED EXPRESSION OF GENES INVOLVED IN THE SUMOYLATION PROCESS.
26219822 2015 Androgen receptor- and PIAS1-regulated gene programs in molecular apocrine breast cancer cells.
25895136 2015 c-Myc is targeted to the proteasome for degradation in a SUMOylation-dependent manner, regulated by PIAS1, SENP7 and RNF4.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25474038 2014 PIAS1 is a crucial factor for prostate cancer cell survival and a valid target in docetaxel resistant cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
More...