Property Summary

NCBI Gene PubMed Count 12
Grant Count 8
R01 Count 4
Funding $676,494.25
PubMed Score 21.08
PubTator Score 18.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (5)

PMID Text
26311540 Inverse correlation was observed between SMN2, SERF1A and NAIP copy number polymorphism and spinal muscular atrophy type.
22854022 the autonomous amyloid-modifying activity of SERF1a observed in living organisms relies on a direct and dedicated manipulation of the early stages in the amyloid aggregation pathway.
21821450 There is a close relationship between SMN2, NAIP and H4F5 gene copy number and spinal muscular atrophy disease severity
20723760 The human orthologs of MOAG-4, SERF2 and SERF1A, are ubiquitously expressed, consistent with a role in a general cellular pathway.
19154529 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARGNQRELARQKNMKKTQEISKGKRKEDSLTASQRKQSSGGQKSESKMSAGPHLPLKAPRENPCFPLPA      1 - 70
AGGSRYYLAYGSITPISAFVFVVFFSVFFPSFYEDFCCWI                                   71 - 110
//

Text Mined References (12)

PMID Year Title
26311540 2015 Joint effect of the SMN2 and SERF1A genes on childhood-onset types of spinal muscular atrophy in Serbian patients.
22854022 2012 SERF protein is a direct modifier of amyloid fiber assembly.
21821450 2012 Correlation of SMN2, NAIP, p44, H4F5 and Occludin genes copy number with spinal muscular atrophy phenotype in Tunisian patients.
20723760 2010 Identification of MOAG-4/SERF as a regulator of age-related proteotoxicity.
19154529 2009 A population-based study of genotypic and phenotypic variability in children with spinal muscular atrophy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
10486205 1999 Comparative sequence analysis of the mouse and human Lgn1/SMA interval.
More...