Property Summary

NCBI Gene PubMed Count 12
PubMed Score 22.17
PubTator Score 18.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession O75920 B7ZKM2 O75919 Q52LK5
Symbols 4F5
H4F5
FAM2A
SERF1
SMAM1

Gene

 Compartment GO Term (2)

Gene RIF (5)

AA Sequence

MARGNQRELARQKNMKKTQEISKGKRKEDSLTASQRKQSSGGQKSESKMSAGPHLPLKAPRENPCFPLPA      1 - 70
AGGSRYYLAYGSITPISAFVFVVFFSVFFPSFYEDFCCWI                                   71 - 110
//

Text Mined References (12)

PMID Year Title