Property Summary

NCBI Gene PubMed Count 57
PubMed Score 58.84
PubTator Score 71.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -1.680 3.1e-03
atypical teratoid / rhabdoid tumor -1.500 1.0e-02
ductal carcinoma in situ -2.600 1.3e-04
glioblastoma -1.100 5.9e-03
group 3 medulloblastoma -2.800 7.5e-07
interstitial cystitis -1.800 5.6e-03
invasive ductal carcinoma -2.800 8.3e-04
medulloblastoma, large-cell -2.700 1.3e-06
nephrosclerosis -1.495 2.2e-02
osteosarcoma 1.294 4.0e-05
pancreatic ductal adenocarcinoma liver m... -1.501 4.8e-02
posterior fossa group A ependymoma 1.400 7.3e-08
primitive neuroectodermal tumor -1.700 4.2e-03
psoriasis -2.200 3.0e-34
ulcerative colitis 1.100 4.4e-02

Protein-protein Interaction (1)

Gene RIF (35)

AA Sequence

MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKYSRWRAKGQALPDVV      1 - 70
AKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFSIFWADDG     71 - 140
LDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAK    141 - 210
INWDQPAEAIHNWIRGNDKVPGAWTEACEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILF    211 - 280
GNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKS    281 - 350
GAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRM    351 - 420
PHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKISARDRGRLMY    421 - 490
RLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGSTIPINQARPNRNLTLTR    491 - 560
KEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNVLPGSG    561 - 630
SLVGQRLSDHPDVRKIGFTGSTEVGKHIMKSCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVF    631 - 700
FNKGENCIAAGRLFVEDSIHDEFVRRVVEEVRKMKVGNPLDRDTDHGPQNHHAHLVKLMEYCQHGVKEGA    701 - 770
TLVCGGNQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFT    771 - 840
RDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY            841 - 902
//

Text Mined References (64)

PMID Year Title