Property Summary

NCBI Gene PubMed Count 54
Grant Count 38
R01 Count 32
Funding $3,109,007.48
PubMed Score 54.10
PubTator Score 71.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (32)

PMID Text
26567272 Data suggest that isoforms of FTHFD occur both in mitochondria and in cytosol; activity of cytosolic FTHFD appears to respond to supply of one-carbon groups in excess of those required for classical one-carbon metabolism. [REVIEW]
25077544 JNK1/2 phosphorylate Bid at Thr59 within the caspase cleavage site in response to ALDH1L1.
24953984 ALDH1 is indicative of stemness and is a biomarker marker in colon cancer.
24651765 one variant in the ALDH1L1 locus, rs2364368, was associated with incident ischemic stroke.
21987076 The results in this study, for the first time, reveal that the mRNA and protein expressions of ALDH1L1 are significantly reduced in hepatocellular carcinoma tissues
21540484 Conserved catalytic residues of the ALDH1L1 aldehyde dehydrogenase domain control binding and discharging of the coenzyme.
21046559 These studies support ALDH1L1 as a general CNS astroglial marker.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20737570 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20729910 inhibition of cell motility by ALDH1L1 associated with dephosphorylation of the actin depolymerizing factor cofilin by PP1 and PP2A
More...

AA Sequence

MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKYSRWRAKGQALPDVV      1 - 70
AKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFSIFWADDG     71 - 140
LDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAK    141 - 210
INWDQPAEAIHNWIRGNDKVPGAWTEACEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILF    211 - 280
GNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKS    281 - 350
GAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRM    351 - 420
PHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKISARDRGRLMY    421 - 490
RLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGSTIPINQARPNRNLTLTR    491 - 560
KEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNVLPGSG    561 - 630
SLVGQRLSDHPDVRKIGFTGSTEVGKHIMKSCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVF    631 - 700
FNKGENCIAAGRLFVEDSIHDEFVRRVVEEVRKMKVGNPLDRDTDHGPQNHHAHLVKLMEYCQHGVKEGA    701 - 770
TLVCGGNQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFT    771 - 840
RDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY            841 - 902
//

Text Mined References (61)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26567272 2015 Division of labour: how does folate metabolism partition between one-carbon metabolism and amino acid oxidation?
25114248 2014 Distinct isoform of FABP7 revealed by screening for retroelement-activated genes in diffuse large B-cell lymphoma.
25077544 2014 JNK1/2 regulate Bid by direct phosphorylation at Thr59 in response to ALDH1L1.
24953984 2014 The impact of Aldehyde dehydrogenase 1 expression on prognosis for metastatic colon cancer.
24651765 2014 Genome-wide meta-analysis of homocysteine and methionine metabolism identifies five one carbon metabolism loci and a novel association of ALDH1L1 with ischemic stroke.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23378610 2013 Genetic variants associated with glycine metabolism and their role in insulin sensitivity and type 2 diabetes.
More...