Property Summary

NCBI Gene PubMed Count 161
PubMed Score 21.26
PubTator Score 369.66

Knowledge Summary


No data available


  Disease Sources (2)



Accession O75888 A8MYD5 B4DVT2 Q541E1 Q5U0G8 Q96HV6 Q9P1M8 Q9P1M9
Symbols APRIL




  Ortholog (6)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

 GO Function (1)

Gene RIF (143)

26986150 plasma level elevated in IgA nephropathy
26950089 Abnormal levels of BAFF/APRIL in pediatric acute lymphoblastic leukemia suggest that BAFF/APRIL are associated with the development and progression of this disease in children
26512887 Host-derived proteins pp32 and APRIL interact with a free form of influenza virus RNA-dependent RNA polymerase and preferentially upregulates viral RNA synthesis rather than cRNA synthesis.
26469782 Data show decrease of serum APRIL levels in diabetic patients with Type-1 Diabetes or Type-2 Diabetes suggesting suggest that APRIL can be considered as a potential modulating cytokine in the inflammatory process of diabetes.
26431901 TNFSF13 and FDX1 have potential roles in IgAN in the Han Chinese population. This information may be useful in the development of early prognostics for IgAN.
26370181 Did not find any positive association between TNFSF13 SNPs and the risk of IgA nephropathy after adjustment for age and sex, but did find a significant and strong correlation with relevant clinical pathological parameters.
26296917 high expression of APRIL in clear cell renal cell carcinoma was correlated with high Fuhrman nuclear grade, high pathologic stage, and poor overall and cancer-specific survival of the patients
26268376 SNPs rs9514828 (BAFF), rs3803800 (APRIL) and rs4985726 (TACI) may be associated with the risk of development of B-cell chronic lymphocytic leukemia in a Polish population.
26243624 results indicate that analysis of serum concentrations of BAFF and APRIL potentially represents a useful tool for the assessment of AIHA disease activity and progression.
26150532 the elevated presence of APRIL and BLyS in B cell-rich areas of chronically inflamed gingiva suggests that these cytokines may contribute to bone loss by promoting the survival and persistence of RANKL-expressing B cells/plasma cells.

AA Sequence

CYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL                                  211 - 250

Text Mined References (162)

PMID Year Title
26986150 2016 Increased APRIL Expression Induces IgA1 Aberrant Glycosylation in IgA Nephropathy.
26950089 2016 Significance of BAFF/APRIL Expression and Their Receptors in Pediatric Patients With Acute Lymphoblastic Leukemia.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26512887 2015 pp32 and APRIL are host cell-derived regulators of influenza virus RNA synthesis from cRNA.
26469782 2015 Decreased Circulating Levels of APRIL: Questioning Its Role in Diabetes.
26431901 2015 Genetic polymorphisms in TNFSF13 and FDX1 are associated with IgA nephropathy in the Han Chinese population.
26370181 2015 Association between CCDC132, FDX1 and TNFSF13 gene polymorphisms and the risk of IgA nephropathy.
26296917 2015 High expression of APRIL correlates with poor prognosis in clear cell renal cell carcinoma.
26268376 2015 Polymorphisms in genes of the BAFF/APRIL system may constitute risk factors of B-CLL--a preliminary study on a Polish population.
26243624 2015 Serum BAFF and APRIL levels in patients with autoimmune hemolytic anemia and their clinical significance.