Property Summary

NCBI Gene PubMed Count 27
Grant Count 23
R01 Count 15
Funding $2,914,348.55
PubMed Score 360.44
PubTator Score 40.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
25318887 Data indicate that Attractin was involved in male reproduction in both human and BALB/c mice, but it exerted a different expression profile in different species.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198559 The levels of both dipeptidyl-peptidase 4 and attractin in circulating monocytes were significantly higher in obese subjects as compared with levels in lean controls or in subjects with type 2 diabetes.
19535787 associated with spermatozoa
19384953 Observational study of gene-disease association. (HuGE Navigator)
19320733 Observational study of gene-disease association. (HuGE Navigator)
16835316 It is the first time expression of attractin on monocytes and provide first data suggesting that drugs directed to DP IV-like enzyme activity could affect monocyte function via attractin inhibition.
12675230 This protein is isolated from human blood and characterized.
10811918 Provides the genomic basis for production of a soluble and membrane form of attractin by alternative splicing. In the process, by sequencing from positionally-determined BAC clones, confirms the localization of attractin to chromosome 20p13.
10086356 The product of the murine "Mahogany" locus, controlling agouti-mediated melanocyte pigmentation and control of energy metabolism, is the murine ortholog of human attractin.
More...

AA Sequence

MVAAAAATEARLRRRTAATAALAGRSGGPHWDWDVTRAGRPGLGAGLRLPRLLSPPLRPRLLLLLLLLSP      1 - 70
PLLLLLLPCEAEAAAAAAAVSGSAAAEAKECDRPCVNGGRCNPGTGQCVCPAGWVGEQCQHCGGRFRLTG     71 - 140
SSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECSWDHLYVYDGDSIYAPLVAAFSGLIVPER    141 - 210
DGNETVPEVVATSGYALLHFFSDAAYNLTGFNITYSFDMCPNNCSGRGECKISNSSDTVECECSENWKGE    211 - 280
ACDIPHCTDNCGFPHRGICNSSDVRGCSCFSDWQGPGCSVPVPANQSFWTREEYSNLKLPRASHKAVVNG    281 - 350
NIMWVVGGYMFNHSDYNMVLAYDLASREWLPLNRSVNNVVVRYGHSLALYKDKIYMYGGKIDSTGNVTNE    351 - 420
LRVFHIHNESWVLLTPKAKEQYAVVGHSAHIVTLKNGRVVMLVIFGHCPLYGYISNVQEYDLDKNTWSIL    421 - 490
HTQGALVQGGYGHSSVYDHRTRALYVHGGYKAFSANKYRLADDLYRYDVDTQMWTILKDSRFFRYLHTAV    491 - 560
IVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSVLPRPDLHHDVNRFGHSAVLHNSTMYVFG    561 - 630
GFNSLLLSDILVFTSEQCDAHRSEAACLAAGPGIRCVWNTGSSQCISWALATDEQEEKLKSECFSKRTLD    631 - 700
HDRCDQHTDCYSCTANTNDCHWCNDHCVPRNHSCSEGQISIFRYENCPKDNPMYYCNKKTSCRSCALDQN    701 - 770
CQWEPRNQECIALPENICGIGWHLVGNSCLKITTAKENYDNAKLFCRNHNALLASLTTQKKVEFVLKQLR    771 - 840
IMQSSQSMSKLTLTPWVGLRKINVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPSTRGLKAATCI    841 - 910
NPLNGSVCERPANHSAKQCRTPCALRTACGDCTSGSSECMWCSNMKQCVDSNAYVASFPFGQCMEWYTMS    911 - 980
TCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYKGPVKMPSQAPTGNFYPQPLLNSSMCLED    981 - 1050
SRYNWSFIHCPACQCNGHSKCINQSICEKCENLTTGKHCETCISGFYGDPTNGGKCQPCKCNGHASLCNT   1051 - 1120
NTGKCFCTTKGVKGDECQLCEVENRYQGNPLRGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQN   1121 - 1190
RDLDMFINASKNFNLNITWAASFSAGTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNF   1191 - 1260
TWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMASRPFAS   1261 - 1330
VNVALETDEEPPDLIGGSIKTVPKPIALEPCFGNKAAVLSVFVRLPRGLGGIPPPGQSGLAVASALVDIS   1331 - 1400
QQMPIVYKEKSGAVRNRKQQPPAQPGTCI                                            1401 - 1429
//

Text Mined References (31)

PMID Year Title
25318887 2014 Expression of Attractin in male reproductive tract of human and mice and its correlation with male reproduction.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198559 2010 Dipeptidyl-peptidase 4 and attractin expression is increased in circulating blood monocytes of obese human subjects.
19535787 2009 Novel partners of SPAG11B isoform D in the human male reproductive tract.
19384953 2009 Genetic variants in pigmentation genes, pigmentary phenotypes, and risk of skin cancer in Caucasians.
19320733 2009 Pigmentation-related genes and their implication in malignant melanoma susceptibility.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
More...