Property Summary

NCBI Gene PubMed Count 55
PubMed Score 48.07
PubTator Score 65.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
psoriasis 6694 1.0e-31
lung carcinoma 2843 3.0e-13
lung cancer 4740 3.2e-05
Atopic dermatitis 952 4.3e-04
intraductal papillary-mucinous carcinoma (IPMC) 2989 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 197 0.0 1.7
Disease Target Count Z-score Confidence
Hereditary spastic paraplegia 5A 1 0.0 5.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis 1.100 4.3e-04
intraductal papillary-mucinous carcinoma... -1.400 1.4e-03
lung cancer -2.100 3.2e-05
lung carcinoma -1.200 3.0e-13
psoriasis 1.100 1.0e-31

 IMPC Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (43)

AA Sequence

MAGEVSAATGRFSLERLGLPGLALAAALLLLALCLLVRRTRRPGEPPLIKGWLPYLGVVLNLRKDPLRFM      1 - 70
KTLQKQHGDTFTVLLGGKYITFILDPFQYQLVIKNHKQLSFRVFSNKLLEKAFSISQLQKNHDMNDELHL     71 - 140
CYQFLQGKSLDILLESMMQNLKQVFEPQLLKTTSWDTAELYPFCSSIIFEITFTTIYGKVIVCDNNKFIS    141 - 210
ELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDL    211 - 280
EIGAHHLGFLWASVANTIPTMFWAMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLI    281 - 350
CLESSIFEALRLSSYSTTIRFVEEDLTLSSETGDYCVRKGDLVAIFPPVLHGDPEIFEAPEEFRYDRFIE    351 - 420
DGKKKTTFFKRGKKLKCYLMPFGTGTSKCPGRFFALMEIKQLLVILLTYFDLEIIDDKPIGLNYSRLLFG    421 - 490
IQYPDSDVLFRYKVKS                                                          491 - 506
//

Text Mined References (57)

PMID Year Title