Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.26
PubTator Score 4.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 1.1e-08
ulcerative colitis 1819 3.0e-06
psoriasis 6694 5.8e-06
cutaneous lupus erythematosus 1057 2.8e-03
inflammatory breast cancer 286 1.7e-02
Disease Target Count Z-score Confidence
Polydactyly 107 3.007 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 2.8e-03
inflammatory breast cancer -1.100 1.7e-02
psoriasis -1.200 5.8e-06
tuberculosis 1.700 1.1e-08
ulcerative colitis -1.100 3.0e-06

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MADTVLFEFLHTEMVAELWAHDPDPGPGGQKMSLSVLEGMGFRVGQALGERLPRETLAFREELDVLKFLC      1 - 70
KDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEAPKFLAFTCGLLRGALYTLGIESVV     71 - 140
TASVAALPVCKFQVVIPKS                                                       141 - 159
//

Text Mined References (16)

PMID Year Title