Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.92
PubTator Score 4.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.200 0.000
cutaneous lupus erythematosus -1.100 0.003
tuberculosis and treatment for 3 months 1.800 0.000
inflammatory breast cancer -1.100 0.017
ulcerative colitis -1.100 0.000

Synonym

Gene

PDB

2C0J   2J3T  

Gene RIF (1)

PMID Text
16697553 Mapping and characterization of mouse Trappc6a, along with a description of the human homolog.

AA Sequence

MADTVLFEFLHTEMVAELWAHDPDPGPGGQKMSLSVLEGMGFRVGQALGERLPRETLAFREELDVLKFLC      1 - 70
KDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEAPKFLAFTCGLLRGALYTLGIESVV     71 - 140
TASVAALPVCKFQVVIPKS                                                       141 - 159
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
21766012 2011 Alzheimer's disease genes are associated with measures of cognitive ageing in the lothian birth cohorts of 1921 and 1936.
21482742 2011 Entry and exit mechanisms at the cis-face of the Golgi complex.
21273506 2011 Primary cilia membrane assembly is initiated by Rab11 and transport protein particle II (TRAPPII) complex-dependent trafficking of Rabin8 to the centrosome.
19416478 2009 TRAPPC2L is a novel, highly conserved TRAPP-interacting protein.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
18930054 2008 Distinct isocomplexes of the TRAPP trafficking factor coexist inside human cells.
16697553 2006 A mouse TRAPP-related protein is involved in pigmentation.
16262728 2005 Biochemical and crystallographic studies reveal a specific interaction between TRAPP subunits Trs33p and Bet3p.
More...