Property Summary

NCBI Gene PubMed Count 22
Grant Count 23
R01 Count 13
Funding $6,356,329.34
PubMed Score 26.95
PubTator Score 14.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
group 4 medulloblastoma -1.200 0.001
medulloblastoma, large-cell -1.600 0.001
tuberculosis -2.400 0.000
pancreatic ductal adenocarcinoma liver m... -2.806 0.001
active Crohn's disease 1.078 0.002
interstitial cystitis -2.200 0.000
lung adenocarcinoma 1.028 0.002
inflammatory breast cancer -1.200 0.001
Pick disease -1.100 0.001
ovarian cancer 1.200 0.017

Gene RIF (5)

PMID Text
27023786 The relationship between C-peptide concentrations and D5D enzyme activity estimates remained significant after adjusting for body mass index, waist circumference, and TNF-alpha.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20144677 The EGR3 may not play a major role in schizophrenia susceptibility in the Chinese Han population.
18660489 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDLVLRVADYYFFTPYVYPATWPEDDIFRQAISLLIVTNVGAYILYFFCATLSYYFVFDHALMKHPQFLK      1 - 70
NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELVVSIISFLFFTDMFIYWIHRG     71 - 140
LHHRLVYKRLHKPHHIWKIPTPFASHAFHPIDGFLQSLPYHIYPFIFPLHKVVYLSLYILVNIWTISIHD    141 - 210
GDFRVPQILQPFINGSAHHTDHHMFFDYNYGQYFTLWDRIGGSFKNPSSFEGKGPLSYVKEMTEGKRSSH    211 - 280
SGNGCKNEKLFNGEFTKTE                                                       281 - 299
//

Text Mined References (23)

PMID Year Title
27023786 2016 Relationship between Body Mass Index, C-Peptide, and Delta-5-Desaturase Enzyme Activity Estimates in Adult Males.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20144677 2010 No association between EGR gene family polymorphisms and schizophrenia in the Chinese population.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12812989 2003 Lathosterolosis: an inborn error of human and murine cholesterol synthesis due to lathosterol 5-desaturase deficiency.
More...