Property Summary

NCBI Gene PubMed Count 20
PubMed Score 114.02
PubTator Score 57.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 4.5e-49
psoriasis 6694 6.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Infective endocarditis 4 3.209 1.6
Malaria 160 3.135 1.6
Pleomorphic adenoma 18 3.036 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 4.000 4.5e-49
psoriasis -1.100 6.2e-03

Gene RIF (12)

AA Sequence

MTENSDKVPIALVGPDDVEFCSPPAYATLTVKPSSPARLLKVGAVVLISGAVLLLFGAIGAFYFWKGSDS      1 - 70
HIYNVHYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIAVNDFQNGITGIRFAGGEKCYIKAQVKAR     71 - 140
IPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQ    141 - 210
RERREVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEG    211 - 280
ICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV                    281 - 334
//

Text Mined References (22)

PMID Year Title