Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.90
PubTator Score 4.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 5.2e-09
psoriasis 6694 9.1e-06
tuberculosis 2010 2.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Isolated cleft palate 4 4.099 2.0
Basal cell carcinoma 54 3.389 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer -1.700 5.2e-09
psoriasis -1.100 9.1e-06
tuberculosis -1.500 2.4e-04

Gene RIF (2)

AA Sequence

MASPSPPPESKGLLTFEDVAVFFTQEEWDYLDPAQRSLYKDVMMENYGNLVSLDVLNRDKDEEPTVKQEI      1 - 70
EEIEEEVEPQGVIVTRIKSEIDQDPMGRETFELVGRLDKQRGIFLWEIPRESLTQEQRMFRENTNIIRKR     71 - 140
PNSEEKCHKCEECGKGFVRKAHFIQHQRVHTGEKPFQCNECGKSFSRSSFVIEHQRIHTGERPYECNYCG    141 - 210
KTFSVSSTLIRHQRIHTGERPYQCNQCKQSFSQRRSLVKHQRIHTGEKPHKCSDCGKAFSWKSHLIEHQR    211 - 280
THTGEKPYHCTKCKKSFSRNSLLVEHQRIHTGERPHKCGECGKAFRLSTYLIQHQKIHTGEKPFLCIECG    281 - 350
KSFSRSSFLIEHQRIHTGERPYQCKECGKSFSQLCNLTRHQRIHTGDKPHKCEECGKAFSRSSGLIQHQR    351 - 420
IHTREKTYPYNETKESFDPNCSLVIQQEVYPKEKSYKCDECGKTFSVSAHLVQHQRIHTGEKPYLCTVCG    421 - 490
KSFSRSSFLIEHQRIHTGERPYLCRQCGKSFSQLCNLIRHQGVHTGNKPHKCDECGKAFSRNSGLIQHQR    491 - 560
IHTGEKPYKCEKCDKSFSQQRSLVNHQKIHAEVKTQETHECDACGEAFNCRISLIQHQKLHTAWMQ        561 - 626
//

Text Mined References (16)

PMID Year Title