Property Summary

NCBI Gene PubMed Count 43
Grant Count 48
R01 Count 13
Funding $7,907,271.41
PubMed Score 9.17
PubTator Score 138.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 4.600 0.000
atypical teratoid/rhabdoid tumor 1.200 0.004

Gene RIF (17)

PMID Text
26824761 A novel frameshift mutation (c.367delC) in ZMYND10, unique for Slavic primary ciliary dyskinesia population (PCD), was found in homozygous state in two unrelated PCD patients.
26043875 Data identified a novel functional BLU promoter that was regulated by Sp1. Furthermore, the hypermethylated -39 CpG in BLU proximal promoter directly reduced its binding with Sp1.
25347745 Data show that the zinc finger MYND-type containing 10 protein BLU gene may be one of the key components of signaling networks controlling tumor microenvironment and angiogenesis.
23891471 Mutations in ZMYND10 cause primary ciliary dyskinesia.
23891469 ZMYND10 is mutated in primary ciliary dyskinesia and interacts with LRRC6.
23628417 Data indicate that BLU could suppress the growth of ovarian carcinoma cells through down-regulation of Bcl-2 protein.
23329649 Methylation of BLU could be a potential prognostic biomarker for advanced ovarian serous carcinoma
22766745 these data indicated that methylation of the BLU promoter region is an early event during hepatocellular carcinoma development.
22349239 The N-terminal of BLU was observed to interact with the C-terminal of SMEK1, a regulatory subunit of protein phosphatase 4. Furthermore, we determined the binding domains that are required for interaction between BLU and sMEK1. The N-terminal of BLU was observed to interact with the C-terminal of sMEK1.
22246278 BLU may play a substantial role in the development and etiology of myelodysplastic syndrome.
More...

AA Sequence

MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPT      1 - 70
LVEELIAVEMWKQKVFPVFCRVEDFKPQNTFPIYMVVHHEASIINLLETVFFHKEVCESAEDTVLDLVDY     71 - 140
CHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQAELMEFEIALKALSVLRYITDCVDSLSLSTLSRML    141 - 210
STHNLPCLLVELLEHSPWSRREGGKLQQFEGSRWHTVAPSEQQKLSKLDGQVWIALYNLLLSPEAQARYC    211 - 280
LTSFAKGRLLKLRAFLTDTLLDQLPNLAHLQSFLAHLTLTETQPPKKDLVLEQIPEIWERLERENRGKWQ    281 - 350
AIAKHQLQHVFSPSEQDLRLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQV    351 - 420
KHWEKHGKTCVLAAQGDRAK                                                      421 - 440
//

Text Mined References (43)

PMID Year Title
26824761 2016 ZMYND10--Mutation Analysis in Slavic Patients with Primary Ciliary Dyskinesia.
26043875 2015 Inactivation of BLU is associated with methylation of Sp1-binding site of BLU promoter in gastric cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25347745 2015 Anti-angiogenic pathway associations of the 3p21.3 mapped BLU gene in nasopharyngeal carcinoma.
25186273 2014 Ciliary beat pattern and frequency in genetic variants of primary ciliary dyskinesia.
23891471 2013 Mutations in ZMYND10, a gene essential for proper axonemal assembly of inner and outer dynein arms in humans and flies, cause primary ciliary dyskinesia.
23891469 2013 ZMYND10 is mutated in primary ciliary dyskinesia and interacts with LRRC6.
23829175 2013 Identification of genes specifically methylated in Epstein-Barr virus-associated gastric carcinomas.
23628417 2013 Tumor suppressor BLU promotes paclitaxel antitumor activity by inducing apoptosis through the down-regulation of Bcl-2 expression in tumorigenesis.
23329649 2013 Epigenetic silencing of BLU through interfering apoptosis results in chemoresistance and poor prognosis of ovarian serous carcinoma patients.
More...