Property Summary

NCBI Gene PubMed Count 21
PubMed Score 141.35
PubTator Score 44.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.003 2.2e-02
Alzheimer's disease -1.300 1.6e-02
atypical teratoid / rhabdoid tumor -1.700 4.3e-03
cystic fibrosis 1.288 8.5e-04
ductal carcinoma in situ 1.500 3.8e-04
ependymoma -1.800 1.3e-02
glioblastoma -1.200 1.4e-03
group 4 medulloblastoma 2.100 2.5e-03
interstitial cystitis -1.200 8.1e-03
intraductal papillary-mucinous neoplasm ... 1.600 2.2e-02
invasive ductal carcinoma 1.600 1.0e-02
lung adenocarcinoma -1.300 1.5e-14
lung cancer -1.100 2.8e-02
medulloblastoma, large-cell -1.200 5.8e-03
non-small cell lung carcinoma -1.800 2.8e-30
oligodendroglioma -2.000 4.4e-02
osteosarcoma 2.596 5.8e-04
ovarian cancer 1.400 1.5e-02
Pick disease -1.200 1.9e-03

Gene RIF (14)

AA Sequence

MASALWTVLPSRMSLRSLKWSLLLLSLLSFFVMWYLSLPHYNVIERVNWMYFYEYEPIYRQDFHFTLREH      1 - 70
SNCSHQNPFLVILVTSHPSDVKARQAIRVTWGEKKSWWGYEVLTFFLLGQEAEKEDKMLALSLEDEHLLY     71 - 140
GDIIRQDFLDTYNNLTLKTIMAFRWVTEFCPNAKYVMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLI    141 - 210
DNYSYRGFYQKTHISYQEYPFKVFPPYCSGLGYIMSRDLVPRIYEMMGHVKPIKFEDVYVGICLNLLKVN    211 - 280
IHIPEDTNLFFLYRIHLDVCQLRRVIAAHGFSSKEIITFWQVMLRNTTCHY                       281 - 331
//

Text Mined References (21)

PMID Year Title