Property Summary

NCBI Gene PubMed Count 21
PubMed Score 109.70
PubTator Score 44.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Blood group p phenotype (finding) 2
Disease Target Count P-value
non-small cell lung carcinoma 413 2.83508771771286E-30
lung adenocarcinoma 2714 2.49876411618708E-19
Pick disease 1893 6.49641827251423E-6
ductal carcinoma in situ 1745 3.82266540027576E-4
osteosarcoma 7933 5.77234713804013E-4
cystic fibrosis 1670 8.53658770671826E-4
glioblastoma 5572 0.00141333768922429
group 4 medulloblastoma 1875 0.00251617892677665
atypical teratoid / rhabdoid tumor 4369 0.00426829022102326
medulloblastoma, large-cell 6234 0.00584328738128712
interstitial cystitis 2299 0.0081175436735782
invasive ductal carcinoma 2950 0.0104774708403059
ependymoma 2514 0.012947794298248
ovarian cancer 8492 0.0154556537929672
Alzheimer's disease 644 0.0163313620240389
adrenocortical carcinoma 1427 0.0170582137074165
lung cancer 4473 0.0279906989020943
oligodendroglioma 2849 0.0440087982908247
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0466044375315679
Disease Target Count Z-score Confidence
hemolytic-uremic syndrome 28 3.056 1.5

Expression

  Differential Expression (19)

Disease log2 FC p
ependymoma -1.800 0.013
oligodendroglioma -2.000 0.044
osteosarcoma 2.596 0.001
group 4 medulloblastoma 2.100 0.003
cystic fibrosis 1.288 0.001
atypical teratoid / rhabdoid tumor -1.700 0.004
glioblastoma -1.200 0.001
medulloblastoma, large-cell -1.200 0.006
adrenocortical carcinoma 1.003 0.017
intraductal papillary-mucinous neoplasm ... 1.700 0.047
lung cancer -1.100 0.028
interstitial cystitis -1.200 0.008
lung adenocarcinoma -1.800 0.000
non-small cell lung carcinoma -1.800 0.000
Alzheimer's disease -1.300 0.016
Pick disease -1.600 0.000
ductal carcinoma in situ 1.500 0.000
invasive ductal carcinoma 1.600 0.010
ovarian cancer 1.400 0.015

Synonym

Accession O75752 D3DNM4 Q3Y531 Q6IAI5 Q8NFM8 Q8NFM9 Q9HA06 Beta-1,3-GalNAc-T1
Symbols P
P1
GLOB
GLCT3
galT3
Gb4Cer
B3GALT3
beta3Gal-T3

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

 GWAS Trait (1)

Gene RIF (14)

PMID Text
26055721 b1,3GalNAc-T1 uses different acceptors to form immunologically distinct glycosphingolipids.
26037356 The Pk phenotype is resulted from 433 C>T mutation in the B3GALNT1 gene.
25521548 TINAGL1 and B3GALNT1 are possible candidates for drug compounds that inhibit their gene expression
24782133 The N-acetylgalactose aminotransferase gene 539G>C mutation resulted in A2B phenotype generation, and individual serum contained the anti-A1 antibody.
23927681 The number of GLOB-null alleles was increased by 50%.
19264528 Observational study of genotype prevalence. (HuGE Navigator)
18839200 Eighteen SNPs in the MC1R gene and P genes were genotyped in 52 individuals by the direct sequencing method, and 4 SNPs (MC1R gene: R163Q and P gene: IVS5 + 1001, IVS13 + 113, and H615R) were selected on the basis of differences in frequencies.
18565761 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
12023287 identification of four inactivating mutations in the UDP-N-acetylgalactosamine: globotriaosylceramide 3-beta-N-acetylgalactosaminyltransferase gene involved in globoside-deficient P(k) blood group phenotype
2829950 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
More...

AA Sequence

MASALWTVLPSRMSLRSLKWSLLLLSLLSFFVMWYLSLPHYNVIERVNWMYFYEYEPIYRQDFHFTLREH      1 - 70
SNCSHQNPFLVILVTSHPSDVKARQAIRVTWGEKKSWWGYEVLTFFLLGQEAEKEDKMLALSLEDEHLLY     71 - 140
GDIIRQDFLDTYNNLTLKTIMAFRWVTEFCPNAKYVMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLI    141 - 210
DNYSYRGFYQKTHISYQEYPFKVFPPYCSGLGYIMSRDLVPRIYEMMGHVKPIKFEDVYVGICLNLLKVN    211 - 280
IHIPEDTNLFFLYRIHLDVCQLRRVIAAHGFSSKEIITFWQVMLRNTTCHY                       281 - 331
//

Text Mined References (21)

PMID Year Title
26055721 2015 Identification of the Molecular and Genetic Basis of PX2, a Glycosphingolipid Blood Group Antigen Lacking on Globoside-deficient Erythrocytes.
26037356 2015 [A rare Pk phenotype caused by a 433 C>T mutation of the ?-1,3-N-acetylgalactosyltransferase gene].
25521548 2014 TINAGL1 and B3GALNT1 are potential therapy target genes to suppress metastasis in non-small cell lung cancer.
24782133 2014 ?-1,3-N-acetylgalactose aminotransferase gene 539G>C mutation leads to the A2B isoform.
23927681 2013 P1/P2 genotyping of known and novel null alleles in the P1PK and GLOB histo-blood group systems.
23599027 2013 Genome-wide association study of age at menarche in African-American women.
18839200 2009 Variants of the melanocortin 1 receptor gene (MC1R) and P gene as indicators of the population origin of an individual.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...