Property Summary

NCBI Gene PubMed Count 21
PubMed Score 109.70
PubTator Score 44.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
ependymoma -1.800 0.013
oligodendroglioma -2.000 0.044
osteosarcoma 2.596 0.001
group 4 medulloblastoma 2.100 0.003
cystic fibrosis 1.288 0.001
atypical teratoid / rhabdoid tumor -1.700 0.004
glioblastoma -1.200 0.001
medulloblastoma, large-cell -1.200 0.006
adrenocortical carcinoma 1.003 0.017
intraductal papillary-mucinous neoplasm ... 1.700 0.047
lung cancer -1.100 0.028
interstitial cystitis -1.200 0.008
lung adenocarcinoma -1.800 0.000
non-small cell lung carcinoma -1.800 0.000
Alzheimer's disease -1.300 0.016
Pick disease -1.600 0.000
ductal carcinoma in situ 1.500 0.000
invasive ductal carcinoma 1.600 0.010
ovarian cancer 1.400 0.015

Synonym

Accession O75752 D3DNM4 Q3Y531 Q6IAI5 Q8NFM8 Q8NFM9 Q9HA06 Beta-1,3-GalNAc-T1
Symbols P
P1
GLOB
GLCT3
galT3
Gb4Cer
B3GALT3
beta3Gal-T3

Gene

PANTHER Protein Class (2)

 GWAS Trait (1)

Gene RIF (14)

PMID Text
26055721 b1,3GalNAc-T1 uses different acceptors to form immunologically distinct glycosphingolipids.
26037356 The Pk phenotype is resulted from 433 C>T mutation in the B3GALNT1 gene.
25521548 TINAGL1 and B3GALNT1 are possible candidates for drug compounds that inhibit their gene expression
24782133 The N-acetylgalactose aminotransferase gene 539G>C mutation resulted in A2B phenotype generation, and individual serum contained the anti-A1 antibody.
23927681 The number of GLOB-null alleles was increased by 50%.
19264528 Observational study of genotype prevalence. (HuGE Navigator)
18839200 Eighteen SNPs in the MC1R gene and P genes were genotyped in 52 individuals by the direct sequencing method, and 4 SNPs (MC1R gene: R163Q and P gene: IVS5 + 1001, IVS13 + 113, and H615R) were selected on the basis of differences in frequencies.
18565761 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
12023287 identification of four inactivating mutations in the UDP-N-acetylgalactosamine: globotriaosylceramide 3-beta-N-acetylgalactosaminyltransferase gene involved in globoside-deficient P(k) blood group phenotype
2829950 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
More...

AA Sequence

MASALWTVLPSRMSLRSLKWSLLLLSLLSFFVMWYLSLPHYNVIERVNWMYFYEYEPIYRQDFHFTLREH      1 - 70
SNCSHQNPFLVILVTSHPSDVKARQAIRVTWGEKKSWWGYEVLTFFLLGQEAEKEDKMLALSLEDEHLLY     71 - 140
GDIIRQDFLDTYNNLTLKTIMAFRWVTEFCPNAKYVMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLI    141 - 210
DNYSYRGFYQKTHISYQEYPFKVFPPYCSGLGYIMSRDLVPRIYEMMGHVKPIKFEDVYVGICLNLLKVN    211 - 280
IHIPEDTNLFFLYRIHLDVCQLRRVIAAHGFSSKEIITFWQVMLRNTTCHY                       281 - 331
//

Text Mined References (21)

PMID Year Title
26055721 2015 Identification of the Molecular and Genetic Basis of PX2, a Glycosphingolipid Blood Group Antigen Lacking on Globoside-deficient Erythrocytes.
26037356 2015 [A rare Pk phenotype caused by a 433 C>T mutation of the ?-1,3-N-acetylgalactosyltransferase gene].
25521548 2014 TINAGL1 and B3GALNT1 are potential therapy target genes to suppress metastasis in non-small cell lung cancer.
24782133 2014 ?-1,3-N-acetylgalactose aminotransferase gene 539G>C mutation leads to the A2B isoform.
23927681 2013 P1/P2 genotyping of known and novel null alleles in the P1PK and GLOB histo-blood group systems.
23599027 2013 Genome-wide association study of age at menarche in African-American women.
18839200 2009 Variants of the melanocortin 1 receptor gene (MC1R) and P gene as indicators of the population origin of an individual.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...