Property Summary

NCBI Gene PubMed Count 23
PubMed Score 17.24
PubTator Score 10.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Venous Thromboembolism 34

Expression

Synonym

Accession O75683 Q5T8U1 Q9BRK9 Q9BTZ5 Q9UK24
Symbols RRP14

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
25898752 the panel of the GST-Surf6-dom protein partners, which were identified by mass-spectrometry, points to putative interactions of human SURF6 with a number of nuclear and nucleolar proteins of other functional groups
25134534 we identified a consistently replicated loci at 9q34.2 (rs633862 near ABO and SURF6, P(meta) = 8.57 x 10(-7)) (P<0.05 in all three stages)

AA Sequence

MASLLAKDAYLQSLAKKICSHSAPEQQARTRAGKTQGSETAGPPKKKRKKTQKKFRKREEKAAEHKAKSL      1 - 70
GEKSPAASGARRPEAAKEEAAWASSSAGNPADGLATEPESVFALDVLRQRLHEKIQEARGQGSAKELSPA     71 - 140
ALEKRRRRKQERDRKKRKRKELRAKEKARKAEEATEAQEVVEATPEGACTEPREPPGLIFNKVEVSEDEP    141 - 210
ASKAQRRKEKRQRVKGNLTPLTGRNYRQLLERLQARQSRLDELRGQDEGKAQELEAKMKWTNLLYKAEGV    211 - 280
KIRDDERLLQEALKRKEKRRAQRQRRWEKRTAGVVEKMQQRQDRRRQNLRRKKAARAERRLLRARKKGRI    281 - 350
LPQDLERAGLV                                                               351 - 361
//

Text Mined References (31)

PMID Year Title
25898752 [Identification of the protein partners of the human nucleolar protein SURF6 in HeLa cells by GST pull-down assay].
25134534 2014 Genome-wide association study identifies new susceptibility loci for epithelial ovarian cancer in Han Chinese women.
24094242 2013 Genome-wide association study on serum alkaline phosphatase levels in a Chinese population.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23267103 2013 Linkage analysis identifies a locus for plasma von Willebrand factor undetected by genome-wide association.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22316485 2012 Development of novel mouse hybridomas producing monoclonal antibodies specific to human and mouse nucleolar protein SURF-6.
22113938 2011 A bead-based approach for large-scale identification of in vitro kinase substrates.
More...