Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.89
PubTator Score 2.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 1.1e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 197 0.0 1.4

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 3.400 1.1e-06

Gene RIF (2)

AA Sequence

MKRLSLVTTNRLSPHGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCAVCFKCINSLQKE      1 - 70
PHGEDLLCCCCSMVSQKNKIRPSWQLERLASHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLI     71 - 140
SDDLRSVRSGCITQNRQDLAERFDVSICILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHRKGRIHLT    141 - 210
TERGFWTVSLRDGSRLSASTVPLTFLFVDRKLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLH    211 - 280
LFFAPPSPPNGDKSVLSICPVINPGTTDAPVHPGEAK                                     281 - 317
//

Text Mined References (7)

PMID Year Title