Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.89
PubTator Score 2.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 3.400 0.000

Gene RIF (2)

PMID Text
20725088 hRFPL1 antiproliferative activity led to an increased cell population in G(2)/M phase and specific cyclin B1 and Cdc2 downregulations.
18656177 the human RFPL1,2,3 genes have a role in neocortex development

AA Sequence

MKRLSLVTTNRLSPHGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCAVCFKCINSLQKE      1 - 70
PHGEDLLCCCCSMVSQKNKIRPSWQLERLASHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLI     71 - 140
SDDLRSVRSGCITQNRQDLAERFDVSICILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHRKGRIHLT    141 - 210
TERGFWTVSLRDGSRLSASTVPLTFLFVDRKLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLH    211 - 280
LFFAPPSPPNGDKSVLSICPVINPGTTDAPVHPGEAK                                     281 - 317
//

Text Mined References (7)

PMID Year Title
20725088 2011 Primate-specific RFPL1 gene controls cell-cycle progression through cyclin B1/Cdc2 degradation.
20009918 2010 A genome-wide association study of carotid atherosclerosis in HIV-infected men.
18656177 2008 Evolutionary forces shape the human RFPL1,2,3 genes toward a role in neocortex development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10508838 1999 Duplications on human chromosome 22 reveal a novel Ret Finger Protein-like gene family with sense and endogenous antisense transcripts.