Property Summary

NCBI Gene PubMed Count 22
PubMed Score 46.77
PubTator Score 15.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.19584698323391E-23
psoriasis 6685 5.42939448710023E-12
lung adenocarcinoma 2714 1.14118249351749E-7
nasopharyngeal carcinoma 1056 1.38641386307992E-7
pilocytic astrocytoma 3086 6.96368366982044E-4
group 4 medulloblastoma 1875 0.00132321448328569
glioblastoma 5572 0.00600211297883644
Disease Target Count Z-score Confidence
Hydrocephalus 60 3.742 1.9
Primary ciliary dyskinesia 75 3.489 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma 5.600 0.000
glioblastoma -1.100 0.006
lung adenocarcinoma -1.900 0.000
group 4 medulloblastoma 1.400 0.001
pilocytic astrocytoma -1.200 0.001
nasopharyngeal carcinoma -3.000 0.000
psoriasis -1.200 0.000

Synonym

Accession O75602 A8K1I8 B4DXZ4 Q5VUX5 Q5VUX6 Q5VUX7 Q6FI74 Q8NHQ6
Symbols pf16
CT141
Repro-SA-1

Gene

  Ortholog (14)

Gene RIF (5)

PMID Text
25405588 These findings demonstrate that SPAG6 might have a role in malignant myeloid hematologic cell proliferation and apoptosis by regulating caspase proteins and p53, suggesting that SPAG6 may be a potential therapeutic target.
25393619 studies demonstrate a role for Spag6 in the pathogenesis of OM in mice, possibly through its role in the regulation of cilia/basal body polarity through the PCP-dependent mechanisms in the middle ear and Eustachian tubes.
20668334 SPAG6 is a S-SOX5 target gene, indicating a key role for S-SOX5 in the formation and function of motile cilia.
16385451 Observational study of gene-disease association. (HuGE Navigator)
12391165 Data describe the cloning of human and mouse Pf20 proteins that interact with Spag6 protein.

AA Sequence

MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRTLLLDVVPTIQQTAALALGRLAN      1 - 70
YNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPG     71 - 140
VKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGA    141 - 210
VAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAK    211 - 280
HTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPED    281 - 350
HIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQVKSKKAIKNILQKCTYLPALEPF    351 - 420
LYDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSCYPEEIVRYYS    421 - 490
PGYSDTLLQRVDSYQPLNN                                                       491 - 509
//

Text Mined References (24)

PMID Year Title
25405588 2015 SPAG6 silencing inhibits the growth of the malignant myeloid cell lines SKM-1 and K562 via activating p53 and caspase activation-dependent apoptosis.
25393619 2014 Otitis media in sperm-associated antigen 6 (Spag6)-deficient mice.
24071998 2013 Lineage-specific duplications of Muroidea Faim and Spag6 genes and atypical accelerated evolution of the parental Spag6 gene.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20668334 2010 Transcriptional regulation of an axonemal central apparatus gene, sperm-associated antigen 6, by a SRY-related high mobility group transcription factor, S-SOX5.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...