Property Summary

NCBI Gene PubMed Count 27
PubMed Score 153.75
PubTator Score 77.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 6.2e-07
glioblastoma -1.300 2.3e-05
medulloblastoma -1.200 7.0e-06
osteosarcoma -2.774 8.0e-10

Protein-protein Interaction (1)

Gene RIF (12)

AA Sequence

MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFF      1 - 70
REDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAF     71 - 140
AKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGAPWPGLAPQSSPVPAGTGNSGEEAVPTPPLP    141 - 210
SSERPLWPLCPLPGPTRVEGETVQGGAIGPSTLSPEPRAWPLHLLQGTAVPGGRSSGGHRASLWGQLPTS    211 - 280
YLPIYTPNVVMPLAPPPTSCPQCPSTSPAYWGVAPETRGPPGLLCDLDALFQGVPPNKSIYDVWVSHPRD    281 - 350
LAAPGPGWLLSWCSL                                                           351 - 365
//

Text Mined References (26)

PMID Year Title