Property Summary

NCBI Gene PubMed Count 26
Grant Count 54
R01 Count 31
Funding $6,094,505.61
PubMed Score 138.24
PubTator Score 77.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.774 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.300 0.000
medulloblastoma -1.200 0.000

Gene RIF (12)

PMID Text
25482028 These results indicate that Smad4 acts as a tumor suppressor by activating FOXH1, and then suppressing the expression of estrogen receptor, in addition to tumor migration and invasion.
21828274 HEB and E2A-bind the SCA motif at regions overlapping SMAD2/3 and FOXH1
20634891 Observational study of gene-disease association. (HuGE Navigator)
19711044 Results suggest that PKA can negatively regulate ERalpha, at least in part, through FoxH1.
19525021 Four genetic variants are found in FOXH1 that are associated with ventricular septal defects in Chinese patients.
19525021 Observational study of gene-disease association. (HuGE Navigator)
19420158 HIV-1 Tat enhances binding of SMAD2, -3 and -4 and their binding partner Fast1 to the JCV DNA control region (CR) to stimulate JCV gene transcription in living cells
18538293 Reduced NODAL signaling via mutation of several pathway members including FOXH1 is linked to heart defects and holoprosencephaly.
16120611 FoxH1 has a role in androgen receptor-mediated transactivation
15982639 These results demonstrate for a functional role for TGF-beta ligands in regulation of mammalian Mixl1, identify FoxH1 as an essential co-activator, and implicate Nodal as the embryonic regulator of Mixl1 in mesendoderm morphogenesis.
More...

AA Sequence

MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFF      1 - 70
REDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAF     71 - 140
AKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGAPWPGLAPQSSPVPAGTGNSGEEAVPTPPLP    141 - 210
SSERPLWPLCPLPGPTRVEGETVQGGAIGPSTLSPEPRAWPLHLLQGTAVPGGRSSGGHRASLWGQLPTS    211 - 280
YLPIYTPNVVMPLAPPPTSCPQCPSTSPAYWGVAPETRGPPGLLCDLDALFQGVPPNKSIYDVWVSHPRD    281 - 350
LAAPGPGWLLSWCSL                                                           351 - 365
//

Text Mined References (25)

PMID Year Title
25482028 2015 Smad4 suppresses the progression of renal cell carcinoma via the activation of forkhead box protein H1.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
21828274 2011 HEB and E2A function as SMAD/FOXH1 cofactors.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
19711044 2009 PKA-mediated stabilization of FoxH1 negatively regulates ERalpha activity.
19525021 2010 Forkhead box H1 (FOXH1) sequence variants in ventricular septal defect.
18922797 2008 Oct25 represses transcription of nodal/activin target genes by interaction with signal transducers during Xenopus gastrulation.
18538293 2008 Reduced NODAL signaling strength via mutation of several pathway members including FOXH1 is linked to human heart defects and holoprosencephaly.
17507406 2007 Cerberus is a feedback inhibitor of Nodal asymmetric signaling in the chick embryo.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
More...