Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
Funding $54,646
PubMed Score 6.33
PubTator Score 5.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.300 0.041
oligodendroglioma -1.300 0.050
osteosarcoma -1.438 0.002
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.003
intraductal papillary-mucinous adenoma (... 1.400 0.017
adult high grade glioma -1.100 0.001
spina bifida -1.026 0.049
gastric carcinoma 1.100 0.022
ductal carcinoma in situ -1.100 0.000
invasive ductal carcinoma -1.400 0.000
ovarian cancer 1.800 0.000
dermatomyositis 1.200 0.001

Synonym

Accession O75554 B7Z4M2 Q32P29 WBP-4
Symbols FBP21

Gene

 Grant Application (1)

PDB

2DK1   2JXW  

Gene RIF (3)

PMID Text
21917930 formin-binding protein 21 (FBP21)-tandem-WW domain binding fosters protein recognition in the pre-spliceosome
19592703 analysis of the Structure and function of the two tandem WW domains of the pre-mRNA splicing factor FBP21 (formin-binding protein 21)
18854154 Knockdown of WW domain binding protein 4 (formin binding protein 21, WBP4) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEA      1 - 70
AALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYY     71 - 140
YDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDDFIPHTSDLPSSKVN    141 - 210
ENSLGTLDESKSSDSHSDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGS    211 - 280
NEEKSKTLKKSNPYGEWQEIKQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMAD    281 - 350
GVAPVFKKRRTENGKSRNLRQRGDDQ                                                351 - 376
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21917930 2011 Multivalent binding of formin-binding protein 21 (FBP21)-tandem-WW domains fosters protein recognition in the pre-spliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19592703 2009 Structure and function of the two tandem WW domains of the pre-mRNA splicing factor FBP21 (formin-binding protein 21).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...