Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.78
PubTator Score 5.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.100 1.2e-03
astrocytic glioma -1.300 4.1e-02
dermatomyositis 1.200 8.5e-04
ductal carcinoma in situ -1.100 3.4e-04
gastric carcinoma 1.100 2.2e-02
glioblastoma -1.200 1.0e-04
intraductal papillary-mucinous adenoma (... 1.400 1.7e-02
invasive ductal carcinoma -1.400 5.0e-04
medulloblastoma, large-cell -1.100 7.6e-03
oligodendroglioma -1.300 5.0e-02
osteosarcoma -1.438 2.0e-03
ovarian cancer -1.100 2.2e-06
spina bifida -1.026 4.9e-02

Gene RIF (4)

AA Sequence

MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEA      1 - 70
AALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYY     71 - 140
YDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDDFIPHTSDLPSSKVN    141 - 210
ENSLGTLDESKSSDSHSDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGS    211 - 280
NEEKSKTLKKSNPYGEWQEIKQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMAD    281 - 350
GVAPVFKKRRTENGKSRNLRQRGDDQ                                                351 - 376
//

Text Mined References (19)

PMID Year Title