Property Summary

NCBI Gene PubMed Count 60
Grant Count 102
R01 Count 60
Funding $6,907,326.65
PubMed Score 3.38
PubTator Score 74.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene

PANTHER Protein Class (1)

Gene RIF (31)

PMID Text
26270645 Study shows that early neural cells transiently express Reelin at the time they leave the presumptive olfactory/vomeronasal epithelium and that Dab 1 is present in the migratory cell mass and in the presumptive ensheathing cells in the absence of reelin.
26028559 this study is the first to provide genetic evidence for DAB1 as a candidate AD liability/protection gene, although the strength of the contribution of DAB1 may differ among populations
24844606 results of this study demonstrated the presence of reelin, its receptors VLDLR and ApoER2 as well as Dab1 in the ENS and might indicate a novel role of the reelin system in regulating neuronal plasticity and pre-synaptic functions in the ENS.
23333377 The finding of this study suggested that variations in DAB1 involved in the Reelin signaling pathway might contribute to genetic susceptibility to autism with Chinese Han decent.
22419519 Variation in genes encoding proteins at the gateway of Reelin signaling: ligands RELN and APOE, their common receptors APOER2 and VLDLR, and adaptor DAB1, was examined.
22394407 show that Reelin-stimulated Notch-1 activation is dependent on Reelin signaling
22163036 alternative splicing of Dab1 is conserved in avian and mammalian species, with Dab1-L driving SFK phosphorylation in both species
21453247 we report for the first time, that DAB1 is significantly up-regulated in human frontal cortex brain samples of Alzheimer disease patients
21315259 Dab1, an essential component of the reelin pathway, is required for glia-independent somal translocation in the neocortex.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKG      1 - 70
VVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVA     71 - 140
IKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPI    141 - 210
RDPETEENIYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLE    211 - 280
LFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLV    281 - 350
QQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPL    351 - 420
ATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTD    421 - 490
DCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDG    491 - 560
SQASSNSDPFGEPSGEPSGDNISPQAGS                                              561 - 588
//

Text Mined References (63)

PMID Year Title
26441085 2015 AKT-independent Reelin signaling requires interactions of heterotrimeric Go and Src.
26270645 2015 Human Neural Cells Transiently Express Reelin during Olfactory Placode Development.
26028559 2015 Functional enrichment analysis of three Alzheimer's disease genome-wide association studies identities DAB1 as a novel candidate liability/protective gene.
25416956 2014 A proteome-scale map of the human interactome network.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
24844606 2014 Expression and regulation of reelin and its receptors in the enteric nervous system.
24535457 2014 A genome-wide association meta-analysis of plasma A? peptides concentrations in the elderly.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23568457 2013 Genetic variants associated with disordered eating.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
More...