Property Summary

NCBI Gene PubMed Count 62
PubMed Score 2.98
PubTator Score 74.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.300 1.1e-03
astrocytic glioma -2.200 1.1e-03
atypical teratoid / rhabdoid tumor -2.200 4.7e-04
Breast cancer -2.100 3.1e-02
ependymoma -2.400 3.2e-03
glioblastoma -1.600 3.5e-03
group 3 medulloblastoma 1.600 6.3e-04
interstitial cystitis -2.100 2.7e-03
intraductal papillary-mucinous adenoma (... -1.100 2.7e-03
lung cancer -1.100 4.4e-02
medulloblastoma, large-cell 1.200 6.4e-03
oligodendroglioma -2.000 1.1e-03
osteosarcoma 1.176 3.6e-07
subependymal giant cell astrocytoma -2.665 2.4e-02

Protein-protein Interaction (1)

Gene RIF (32)

AA Sequence

MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKG      1 - 70
VVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVA     71 - 140
IKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPI    141 - 210
RDPETEENIYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLE    211 - 280
LFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLV    281 - 350
QQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPL    351 - 420
ATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTD    421 - 490
DCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDG    491 - 560
SQASSNSDPFGEPSGEPSGDNISPQAGS                                              561 - 588
//

Text Mined References (65)

PMID Year Title