Property Summary

NCBI Gene PubMed Count 37
Grant Count 105
Funding $52,749,848.12
PubMed Score 24.41
PubTator Score 26.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 2.618 0.000
psoriasis -1.100 0.003
osteosarcoma 1.757 0.000
pancreatic ductal adenocarcinoma liver m... -1.569 0.041
intraductal papillary-mucinous neoplasm ... -1.400 0.023
Breast cancer 2.200 0.035
ovarian cancer 3.000 0.000

Synonym

Accession O75534 A8K281 E9PGZ0 G5E9Q2 O94961 Q5TF04 Q5TF05 Q68DF1 Q68DI9 Q9Y2S4
Symbols UNR
D1S155E

Gene

PDB

1WFQ   1X65   2YTV   2YTX   2YTY  

Gene RIF (13)

PMID Text
26614667 Studies indicate that Unr (upstream of N-ras) is post-translationally modified by phosphorylation and lysine acetylation.
25631074 Cellular biotinylated cold shock domain containing E1, RNA-binding (CSDE1) protein is incorporated into HIV-1 Gag virus-like particles
25576733 Hepsin suppressed CDK11p58 internal ribosome entry site activity in prostate cancer cells by modulating UNR expression and eIF-2alpha phosphorylation.
24189344 Study suggests TRIM33 and NRAS-CSDE1 as candidate genes for autism, and may provide a novel insight into the etiology of autism
22190034 Cellular biotinylated cold shock domain containing E1, RNA-binding (CSDE1) protein is incorporated into HIV-1 Gag virus-like particles
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17947529 The data suggest that Unr acts as an RNA chaperone on rhinovirus RNA 5' UTR to maintain a complex tertiary internal ribosome entry site structure required for translational competency.
More...

AA Sequence

MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVE      1 - 70
FEVSSDRRTGKPIAVKLVKIKQEILPEERMNGQVVCAVPHNLESKSPAAPGQSPTGSVCYERNGEVFYLT     71 - 140
YTPEDVEGNVQLETGDKINFVIDNNKHTGAVSARNIMLLKKKQARCQGVVCAMKEAFGFIERGDVVKEIF    141 - 210
FHYSEFKGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPSKNQN    211 - 280
DPLPGRIKVDFVIPKELPFGDKDTKSKVTLLEGDHVRFNISTDRRDKLERATNIEVLSNTFQFTNEAREM    281 - 350
GVIAAMRDGFGFIKCVDRDVRMFFHFSEILDGNQLHIADEVEFTVVPDMLSAQRNHAIRIKKLPKGTVSF    351 - 420
HSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVKLTIAFQAKDVEGSTSPQIGDKVE    421 - 490
FSISDKQRPGQQVATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYSEFSGDVDSLELGD    491 - 560
MVEYSLSKGKGNKVSAEKVNKTHSVNGITEEADPTIYSGKVIRPLRSVDPTQTEYQGMIEIVEEGDMKGE    561 - 630
VYPFGIVGMANKGDCLQKGESVKFQLCVLGQNAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLFF    631 - 700
HVKEVQDGIELQAGDEVEFSVILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNITLDDASAPRL    701 - 770
MVLRQPRGPDNSMGFGAERKIRQAGVID                                              771 - 798
//

Text Mined References (49)

PMID Year Title
26614667 2015 Regulation of the expression and activity of Unr in mammalian cells.
25576733 2015 Hepsin inhibits CDK11p58 IRES activity by suppressing unr expression and eIF-2? phosphorylation in prostate cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24189344 2014 Common genetic variants on 1p13.2 associate with risk of autism.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...