Property Summary

NCBI Gene PubMed Count 32
Grant Count 15
R01 Count 13
Funding $1,029,417.95
PubMed Score 176.09
PubTator Score 98.15

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (21)

PMID Text
27487218 data identify a new mechanism underlying tumour cell extravasation and metastasis, and suggest endothelial DR6-mediated necroptotic signalling pathways as targets for anti-metastatic therapies
25113253 Increase in the expression levels of mRNA and protein for the death receptor 6 is associated with various types of gynaecological malignancy.
24806670 These results provide direct support for the model that APP and DR6 function cell autonomously and in the same pathway to control pruning
24806669 Our results support the view that DR6 functions with APP to modulate synaptic density in the adult CNS
24696529 Circulating levels of DR6 and Gpm6B correlate with breast cancer tumor grade.
24374337 our findings provide new insight into a novel mechanism by which DR6 induces downstream signaling in response to an agonist antibody.
24028773 The present findings suggested that DR6 is involved in the pathogenesis of endometriosis by creating the proliferative and anti-apoptotic characteristics of endometriosis.
22761420 DR6-induced apoptosis occurs through a new pathway that is different from the type I and type II pathways through interacting with Bax.
22567163 DR6 serum protein may be a tool to aid in the diagnosis of some sarcomatous tumors to improve treatment planning.
22525750 SAXS measurements on the ectodomain suggested that a dimer defines the minimal physical unit of an unliganded DR6 molecule in solution.
More...

AA Sequence

MGTSPSSSTALASCSRIARRATATMIAGSLLLLGFLSTTTAQPEQKASNLIGTYRHVDRATGQVLTCDKC      1 - 70
PAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQS     71 - 140
NATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNV    141 - 210
CGTLPSFSSSTSPSPGTAIFPRPEHMETHEVPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTS    211 - 280
SARGKEDVNKTLPNLQVVNHQQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHL    281 - 350
PWMIVLFLLLVLVVIVVCSIRKSSRTLKKGPRQDPSAIVEKAGLKKSMTPTQNREKWIYYCNGHGIDILK    351 - 420
LVAAQVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLISALRQHRRNDV    421 - 490
VEKIRGLMEDTTQLETDKLALPMSPSPLSPSPIPSPNAKLENSALLTVEPSPQDKNKGFFVDESEPLLRC    491 - 560
DSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIFDDMLHFLNPEELRVIEEIPQAEDKLDRLFE    561 - 630
IIGVKSQEASQTLLDSVYSHLPDLL                                                 631 - 655
//

Text Mined References (34)

PMID Year Title
27487218 2016 Tumour-cell-induced endothelial cell necroptosis via death receptor 6 promotes metastasis.
25113253 2014 Vascular marker expression during the development of various types of gynaecological malignancy.
24806670 2014 Genetic analysis reveals that amyloid precursor protein and death receptor 6 function in the same pathway to control axonal pruning independent of ?-secretase.
24806669 2014 A death receptor 6-amyloid precursor protein pathway regulates synapse density in the mature CNS but does not contribute to Alzheimer's disease-related pathophysiology in murine models.
24696529 2014 Breast carcinoma progression and tumour vascular markers related to apoptotic mechanisms.
24374337 2014 Agonist antibody activates death receptor 6 downstream signaling involving TRADD recruitment.
24028773 2013 Death receptor 6 is epigenetically silenced by histone deacetylation in endometriosis and promotes the pathogenesis of endometriosis.
23559013 2013 A DR6/p75(NTR) complex is responsible for ?-amyloid-induced cortical neuron death.
22761420 2012 Death receptor 6 induces apoptosis not through type I or type II pathways, but via a unique mitochondria-dependent pathway by interacting with Bax protein.
22567163 2012 DR6 as a diagnostic and predictive biomarker in adult sarcoma.
More...