Property Summary

NCBI Gene PubMed Count 32
PubMed Score 176.09
PubTator Score 98.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 8.82883204141042E-18
non-small cell lung cancer 2798 2.57493147043011E-15
pilocytic astrocytoma 3086 6.12823617639064E-11
psoriasis 6685 2.91144438583474E-10
juvenile dermatomyositis 1189 8.40634990654458E-10
Duchenne muscular dystrophy 602 2.83226726297468E-8
lung adenocarcinoma 2714 3.5077573340302E-8
cystic fibrosis 1670 9.02534093418533E-8
pancreatic cancer 2300 4.19414102458195E-7
breast carcinoma 1614 9.81263058048104E-6
atypical teratoid/rhabdoid tumor 1095 5.90077435999831E-5
lung cancer 4473 6.83970474854599E-5
ovarian cancer 8492 9.65246506151557E-5
malignant mesothelioma 3163 1.48775663955672E-4
tuberculosis 1563 4.41626608012202E-4
pituitary cancer 1972 0.0011282461195178
Becker muscular dystrophy 187 0.00119316953996481
medulloblastoma, large-cell 6234 0.00120172344335613
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00135043670713113
interstitial cystitis 2299 0.00155323303673578
nasopharyngeal carcinoma 1056 0.00276827145647801
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00313535122827689
cutaneous lupus erythematosus 1056 0.0038233547761113
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00548753101713671
pancreatic carcinoma 567 0.00852195590010785
Pick disease 1893 0.0132171616421802
diabetes mellitus 1663 0.0148134087948457
glioblastoma 5572 0.016284362911368
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0245873017506393
Gaucher disease type 3 76 0.0292933177366443
Disease Target Count Z-score Confidence
Brain cancer 24 0.0 1.0

Expression

Synonym

Accession O75509 B2RDI9 Q0D2P5 Q96D86
Symbols DR6
CD358
BM-018

Gene

PDB

2DBH   3QO4   3U3P   3U3Q   3U3S   3U3T   3U3V  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

 GWAS Trait (1)

 CSPA Cell Line (4)

Gene RIF (21)

PMID Text
27487218 data identify a new mechanism underlying tumour cell extravasation and metastasis, and suggest endothelial DR6-mediated necroptotic signalling pathways as targets for anti-metastatic therapies
25113253 Increase in the expression levels of mRNA and protein for the death receptor 6 is associated with various types of gynaecological malignancy.
24806670 These results provide direct support for the model that APP and DR6 function cell autonomously and in the same pathway to control pruning
24806669 Our results support the view that DR6 functions with APP to modulate synaptic density in the adult CNS
24696529 Circulating levels of DR6 and Gpm6B correlate with breast cancer tumor grade.
24374337 our findings provide new insight into a novel mechanism by which DR6 induces downstream signaling in response to an agonist antibody.
24028773 The present findings suggested that DR6 is involved in the pathogenesis of endometriosis by creating the proliferative and anti-apoptotic characteristics of endometriosis.
22761420 DR6-induced apoptosis occurs through a new pathway that is different from the type I and type II pathways through interacting with Bax.
22567163 DR6 serum protein may be a tool to aid in the diagnosis of some sarcomatous tumors to improve treatment planning.
22525750 SAXS measurements on the ectodomain suggested that a dimer defines the minimal physical unit of an unliganded DR6 molecule in solution.
More...

AA Sequence

MGTSPSSSTALASCSRIARRATATMIAGSLLLLGFLSTTTAQPEQKASNLIGTYRHVDRATGQVLTCDKC      1 - 70
PAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQS     71 - 140
NATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNV    141 - 210
CGTLPSFSSSTSPSPGTAIFPRPEHMETHEVPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTS    211 - 280
SARGKEDVNKTLPNLQVVNHQQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHL    281 - 350
PWMIVLFLLLVLVVIVVCSIRKSSRTLKKGPRQDPSAIVEKAGLKKSMTPTQNREKWIYYCNGHGIDILK    351 - 420
LVAAQVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLISALRQHRRNDV    421 - 490
VEKIRGLMEDTTQLETDKLALPMSPSPLSPSPIPSPNAKLENSALLTVEPSPQDKNKGFFVDESEPLLRC    491 - 560
DSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIFDDMLHFLNPEELRVIEEIPQAEDKLDRLFE    561 - 630
IIGVKSQEASQTLLDSVYSHLPDLL                                                 631 - 655
//

Text Mined References (34)

PMID Year Title
27487218 2016 Tumour-cell-induced endothelial cell necroptosis via death receptor 6 promotes metastasis.
25113253 2014 Vascular marker expression during the development of various types of gynaecological malignancy.
24806670 2014 Genetic analysis reveals that amyloid precursor protein and death receptor 6 function in the same pathway to control axonal pruning independent of ?-secretase.
24806669 2014 A death receptor 6-amyloid precursor protein pathway regulates synapse density in the mature CNS but does not contribute to Alzheimer's disease-related pathophysiology in murine models.
24696529 2014 Breast carcinoma progression and tumour vascular markers related to apoptotic mechanisms.
24374337 2014 Agonist antibody activates death receptor 6 downstream signaling involving TRADD recruitment.
24028773 2013 Death receptor 6 is epigenetically silenced by histone deacetylation in endometriosis and promotes the pathogenesis of endometriosis.
23559013 2013 A DR6/p75(NTR) complex is responsible for ?-amyloid-induced cortical neuron death.
22761420 2012 Death receptor 6 induces apoptosis not through type I or type II pathways, but via a unique mitochondria-dependent pathway by interacting with Bax protein.
22567163 2012 DR6 as a diagnostic and predictive biomarker in adult sarcoma.
More...