Property Summary

NCBI Gene PubMed Count 33
PubMed Score 178.70
PubTator Score 98.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Brain cancer 30 0.0 1.2
Panic disorder 61 0.0 1.0

Expression

  Differential Expression (30)

Disease log2 FC p
Astrocytoma, Pilocytic 2.600 1.3e-10
atypical teratoid/rhabdoid tumor -1.200 5.9e-05
Becker muscular dystrophy 1.029 1.2e-03
breast carcinoma -1.600 9.8e-06
cutaneous lupus erythematosus 1.200 3.6e-02
cystic fibrosis 3.178 9.0e-08
diabetes mellitus -1.100 1.5e-02
Duchenne muscular dystrophy 1.225 2.8e-08
Gaucher disease type 3 -1.900 2.9e-02
glioblastoma 1.900 1.6e-02
interstitial cystitis -1.400 1.6e-03
intraductal papillary-mucinous adenoma (... 2.200 1.4e-03
intraductal papillary-mucinous carcinoma... 2.200 3.1e-03
intraductal papillary-mucinous neoplasm ... 1.400 3.2e-03
juvenile dermatomyositis 1.285 8.4e-10
lung adenocarcinoma 1.200 3.3e-12
lung cancer 2.500 6.8e-05
lung carcinoma 1.400 8.8e-18
malignant mesothelioma -1.200 1.5e-04
medulloblastoma, large-cell -1.200 1.2e-03
nasopharyngeal carcinoma -1.100 7.8e-03
non-small cell lung cancer 2.010 2.6e-15
ovarian cancer -1.500 1.7e-04
pancreatic cancer -1.200 8.5e-03
pancreatic carcinoma -1.200 8.5e-03
pancreatic ductal adenocarcinoma liver m... 1.666 2.5e-02
Pick disease -1.100 3.2e-03
pituitary cancer 1.800 1.1e-03
psoriasis 1.500 1.3e-06
tuberculosis -2.200 4.4e-04

 CSPA Cell Line (4)

Gene RIF (23)

AA Sequence

MGTSPSSSTALASCSRIARRATATMIAGSLLLLGFLSTTTAQPEQKASNLIGTYRHVDRATGQVLTCDKC      1 - 70
PAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQS     71 - 140
NATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNV    141 - 210
CGTLPSFSSSTSPSPGTAIFPRPEHMETHEVPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTS    211 - 280
SARGKEDVNKTLPNLQVVNHQQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHL    281 - 350
PWMIVLFLLLVLVVIVVCSIRKSSRTLKKGPRQDPSAIVEKAGLKKSMTPTQNREKWIYYCNGHGIDILK    351 - 420
LVAAQVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLISALRQHRRNDV    421 - 490
VEKIRGLMEDTTQLETDKLALPMSPSPLSPSPIPSPNAKLENSALLTVEPSPQDKNKGFFVDESEPLLRC    491 - 560
DSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIFDDMLHFLNPEELRVIEEIPQAEDKLDRLFE    561 - 630
IIGVKSQEASQTLLDSVYSHLPDLL                                                 631 - 655
//

Text Mined References (35)

PMID Year Title