Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.16
PubTator Score 5.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 2.56559633505433E-12
pediatric high grade glioma 2712 4.23755828931457E-8
glioblastoma 5572 4.53605358078144E-5
primitive neuroectodermal tumor 3031 1.50381118661591E-4
group 3 medulloblastoma 2254 1.94748776190964E-4
Pick disease 1893 2.9038320971621E-4

Expression

  Differential Expression (6)

Disease log2 FC p
posterior fossa group A ependymoma 1.400 0.000
glioblastoma 1.100 0.000
primitive neuroectodermal tumor 1.200 0.000
pediatric high grade glioma 1.200 0.000
group 3 medulloblastoma 1.300 0.000
Pick disease 1.100 0.000

Synonym

Accession O75414 B4DGW7 B4DM99 Q53HM5 Q96E73 Q9BQ63 NDK 6
Symbols NDK 6
NM23-H6
IPIA-ALPHA

Gene

PANTHER Protein Class (3)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (2)

PMID Text
25496667 Genome-wide shRNA screening identifies NME6, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQ      1 - 70
RLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASRE     71 - 140
IAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA                            141 - 186
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19852809 2009 Nme protein family evolutionary history, a vertebrate perspective.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...