Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.17
PubTator Score 5.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.300 7.4e-14
glioblastoma 1.100 4.5e-05
group 3 medulloblastoma 1.300 1.9e-04
pediatric high grade glioma 1.200 4.2e-08
Pick disease 1.100 2.9e-04
primitive neuroectodermal tumor 1.200 1.5e-04

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQ      1 - 70
RLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASRE     71 - 140
IAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA                            141 - 186
//

Text Mined References (14)

PMID Year Title