Property Summary

NCBI Gene PubMed Count 20
Grant Count 9
R01 Count 9
Funding $525,388.11
PubMed Score 26.15
PubTator Score 19.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -2.100 0.000
osteosarcoma -1.037 0.001
posterior fossa group B ependymoma -1.600 0.000
glioblastoma -1.100 0.000
adult high grade glioma -1.200 0.003
atypical teratoid/rhabdoid tumor -1.100 0.000
group 3 medulloblastoma -1.500 0.025
subependymal giant cell astrocytoma -1.151 0.016

Gene RIF (10)

PMID Text
26691157 TRIM3 functions as a tumour suppressor in CRC progression. This tumour-suppressive function is exerted partially through regulation of p53 protein.
26514622 Studies indicate most-studied TRIpartite Motif (TRIM)-NHL proteins TRIM2, TRIM3, TRIM32 and TRIM71, and their mutations have been linked to diseases.
24994609 TRIM3 may play a significant role in hepatocellular carcinoma progression.TRIM3 is downregulated in hepatocellular carcinoma at both the mRNA and protein levels and that low TRIM3 expression is correlated with an unfavorable prognosis.
24947043 TRIM3 acts as a tumor suppressor in GBM by restoring asymmetric cell division.
23318451 Data indicate TRIM3 and p21 interact in cells.
20543135 brain-expressed RING finger protein (BERP) is a gene whose expression is up-regulated in a p53-dependent manner
20173306 TRIM63 is a candidate for genes mediating the glucocorticoid-induced promotion of osteoblastic differentiation.
19250537 Loss of heterozygosity of chromosome segment 11p15.5 in malignant gliomas suggests TRIM3 as a candidate brain tumor suppressor gene.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
15772161 the endosome-associated protein hrs is a subunit of a protein complex containing actinin-4, BERP, and myosin V that is necessary for efficient TfR recycling but not for EGFR degradation

AA Sequence

MAKREDSPGPEVQPMDKQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIPAQSLTLSCPVCRQTSILPE      1 - 70
QGVSALQNNFFISSLMEAMQQAPDGAHDPEDPHPLSVVAGRPLSCPNHEGKTMEFYCEACETAMCGECRA     71 - 140
GEHREHGTVLLRDVVEQHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQ    141 - 210
ALQQRKQALVSDLETICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAA    211 - 280
LAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHETVATGEGLRQALVGQPASLTVTTKDK    281 - 350
DGRLVRTGSAELRAEITGPDGTRLPVPVVDHKNGTYELVYTARTEGELLLSVLLYGQPVRGSPFRVRALR    351 - 420
PGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRGREKGEFTNLQ    421 - 490
GVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAVDTNGDIIVADYDNRWVSIF    491 - 560
SPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAV    561 - 630
NNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSG    631 - 700
SFLSYINTSAEPLYGPQGLALTSDGHVVVADAGNHCFKAYRYLQ                              701 - 744
//

Text Mined References (25)

PMID Year Title
26691157 2016 Potential role of TRIM3 as a novel tumour suppressor in colorectal cancer (CRC) development.
26514622 2015 TRIM-NHL proteins in development and disease.
24994609 2014 Decreased expression of TRIM3 is associated with poor prognosis in patients with primary hepatocellular carcinoma.
24947043 2014 Human Brat ortholog TRIM3 is a tumor suppressor that regulates asymmetric cell division in glioblastoma.
23318451 2014 TRIM3, a tumor suppressor linked to regulation of p21(Waf1/Cip1.).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20543135 2010 Identification of BERP (brain-expressed RING finger protein) as a p53 target gene that modulates seizure susceptibility through interacting with GABA(A) receptors.
20173306 2010 Glucocorticoid-induced gene tripartite motif-containing 63 (TRIM63) promotes differentiation of osteoblastic cells.
19460345 2009 Monoubiquitinylation regulates endosomal localization of Lst2, a negative regulator of EGF receptor signaling.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...