Property Summary

NCBI Gene PubMed Count 8
PubMed Score 77.78
PubTator Score 42.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma multiforme 347 2.54236724430316E-8
tuberculosis and treatment for 6 months 686 2.55499130314732E-4
adult high grade glioma 2148 0.0155041204532307
active ulcerative colitis 477 0.0245294563440254

Expression

  Differential Expression (4)

Synonym

Accession O75366 B2RAU7 Q2NKM9
Symbols p92
DOC6
ADVIL

Gene

PDB

1UND  

  Ortholog (10)

Pathway (1)

Gene RIF (2)

PMID Text
18022635 Predicting the effect of a point mutation on a protein fold: the villin and advillin headpieces and their Pro62Ala mutants.
15096633 NMR structure of the C-terminal headpiece subdomains of advillin. Evaluation of F-actin-binding requirements.

AA Sequence

MPLTSAFRAVDNDPGIIVWRIEKMELALVPVSAHGNFYEGDCYVILSTRRVASLLSQDIHFWIGKDSSQD      1 - 70
EQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFKQGIIYKQGGVASGMKHVETNTYDVKRLLHVK     71 - 140
GKRNIRATEVEMSWDSFNRGDVFLLDLGKVIIQWNGPESNSGERLKAMLLAKDIRDRERGGRAKIGVIEG    141 - 210
DKEAASPELMKVLQDTLGRRSIIKPTVPDEIIDQKQKSTIMLYHISDSAGQLAVTEVATRPLVQDLLNHD    211 - 280
DCYILDQSGTKIYVWKGKGATKAEKQAAMSKALGFIKMKSYPSSTNVETVNDGAESAMFKQLFQKWSVKD    281 - 350
QTMGLGKTFSIGKIAKVFQDKFDVTLLHTKPEVAAQERMVDDGNGKVEVWRIENLELVPVEYQWYGFFYG    351 - 420
GDCYLVLYTYEVNGKPHHILYIWQGRHASQDELAASAYQAVEVDRQFDGAAVQVRVRMGTEPRHFMAIFK    421 - 490
GKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPAFASSLNSNDVFLLRTQAEHYLWYGKGSS    491 - 560
GDERAMAKELASLLCDGSENTVAEGQEPAEFWDLLGGKTPYANDKRLQQEILDVQSRLFECSNKTGQFVV    561 - 630
TEITDFTQDDLNPTDVMLLDTWDQVFLWIGAEANATEKESALATAQQYLHTHPSGRDPDTPILIIKQGFE    631 - 700
PPIFTGWFLAWDPNIWSAGKTYEQLKEELGDAAAIMRITADMKNATLSLNSNDSEPKYYPIAVLLKNQNQ    701 - 770
ELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALPGWKQLQMKKEKGLF                         771 - 819
//

Text Mined References (10)

PMID Year Title
20393563 2010 Functional genomic screen for modulators of ciliogenesis and cilium length.
18022635 2008 Predicting the effect of a point mutation on a protein fold: the villin and advillin headpieces and their Pro62Ala mutants.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15096633 2004 Solution structures of the C-terminal headpiece subdomains of human villin and advillin, evaluation of headpiece F-actin-binding requirements.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12034507 2002 Genomic structure, chromosome mapping and expression analysis of the human AVIL gene, and its exclusion as a candidate for locus for inflammatory bowel disease at 12q13-14 (IBD2).
11287316 2001 Mac-1-dependent tyrosine phosphorylation during neutrophil adhesion.
9664034 1998 Advillin (p92): a new member of the gelsolin/villin family of actin regulatory proteins.