Property Summary

NCBI Gene PubMed Count 44
PubMed Score 60.92
PubTator Score 64.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 2.300 1.4e-04
astrocytoma 1.100 2.0e-08
Astrocytoma, Pilocytic 2.300 2.3e-07
atypical teratoid / rhabdoid tumor 3.700 1.8e-11
ductal carcinoma in situ 1.100 1.5e-03
ependymoma 2.700 3.8e-13
glioblastoma 2.400 7.5e-06
group 3 medulloblastoma 1.800 2.7e-02
intraductal papillary-mucinous neoplasm ... 1.500 3.9e-02
lung adenocarcinoma 1.918 2.9e-10
lung cancer 1.700 6.7e-05
lung carcinoma -2.000 1.1e-21
non-small cell lung cancer 1.104 1.4e-10
ovarian cancer 2.000 1.5e-04
Pick disease 1.200 7.9e-03
primitive neuroectodermal tumor 2.000 3.1e-04
sarcoidosis 1.200 1.0e-02
subependymal giant cell astrocytoma 1.969 2.8e-02

Gene RIF (34)

AA Sequence

MQSKVTGNMPTQSLLMYMDGPEVIGSSLGSPMEMEDALSMKGTAVVPFRATQEKNVIQIEGYMPLDCMFC      1 - 70
SQTFTHSEDLNKHVLMQHRPTLCEPAVLRVEAEYLSPLDKSQVRTEPPKEKNCKENEFSCEVCGQTFRVA     71 - 140
FDVEIHMRTHKDSFTYGCNMCGRRFKEPWFLKNHMRTHNGKSGARSKLQQGLESSPATINEVVQVHAAES    141 - 210
ISSPYKICMVCGFLFPNKESLIEHRKVHTKKTAFGTSSAQTDSPQGGMPSSREDFLQLFNLRPKSHPETG    211 - 280
KKPVRCIPQLDPFTTFQAWQLATKGKVAICQEVKESGQEGSTDNDDSSSEKELGETNKGSCAGLSQEKEK    281 - 350
CKHSHGEAPSVDADPKLPSSKEKPTHCSECGKAFRTYHQLVLHSRVHKKDRRAGAESPTMSVDGRQPGTC    351 - 420
SPDLAAPLDENGAVDRGEGGSEDGSEDGLPEGIHLDKNDDGGKIKHLTSSRECSYCGKFFRSNYYLNIHL    421 - 490
RTHTGEKPYKCEFCEYAAAQKTSLRYHLERHHKEKQTDVAAEVKNDGKNQDTEDALLTADSAQTKNLKRF    491 - 560
FDGAKDVTGSPPAKQLKEMPSVFQNVLGSAVLSPAHKDTQDFHKNAADDSADKVNKNPTPAYLDLLKKRS    561 - 630
AVETQANNLICRTKADVTPPPDGSTTHNLEVSPKEKQTETAADCRYRPSVDCHEKPLNLSVGALHNCPAI    631 - 700
SLSKSLIPSITCPFCTFKTFYPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSS    701 - 770
FCKPKPKSAFPAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSE    771 - 840
MFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNINGSIDYPAKNDSPWAPPGRDYFCNRSASNTAA    841 - 910
EFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCVYPSQALPPKPRFLSSSEVDS    911 - 980
PNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQHLSNSMAQKRNYENFIGNAHYRPNDKKT      981 - 1048
//

Text Mined References (50)

PMID Year Title