Property Summary

NCBI Gene PubMed Count 39
PubMed Score 59.33
PubTator Score 64.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.07547616045031E-21
ependymoma 2514 3.79905364986468E-13
atypical teratoid/rhabdoid tumor 1095 1.614510430169E-11
non-small cell lung cancer 2798 1.43794418077387E-10
lung adenocarcinoma 2714 2.86295852029531E-10
astrocytoma 1493 2.04940135736134E-8
pilocytic astrocytoma 3086 2.16535616077418E-7
pediatric high grade glioma 2712 3.89840571760588E-7
glioblastoma 5572 9.14206009429581E-6
lung cancer 4473 6.74640834463489E-5
sonic hedgehog group medulloblastoma 1482 1.01623154082357E-4
ovarian cancer 8492 1.54602669253918E-4
primitive neuroectodermal tumor 3031 3.08256172234592E-4
ductal carcinoma in situ 1745 0.00145996549888822
Pick disease 1893 0.00785637802703995
sarcoidosis 368 0.0104481774606877
subependymal giant cell astrocytoma 2287 0.0278773440003399
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.039214739487032
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.783 1.9

Expression

  Differential Expression (18)

Synonym

Accession O75362 E1P5Y6 Q14DB8
Symbols ZABC1

Gene

PDB

2HU2   3UK3   4F2J   4IS1  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Pathway (1)

Gene RIF (29)

PMID Text
26431164 Review: highlight the downstream molecular targets and signaling pathways of ZNF217 in tumor cells.
25824781 High expression of ZNF217 is associated with enhanced cell migration and invasion in colorectal carcinoma.
25729968 Two polymorphisms in ZNF217 in Mexican patients with colorectal cancer, were studied.
25621839 ZNF217 has an oncogenic role in colorectal cancer and is regulated by miR-203.
25202062 ZNF217 expression seems to be a novel prognostic biomarker in gastric cancer.
25031722 we conclude that ZNF217 may contribute to ovarian cancer invasion and metastasis, and associated with worse clinical outcomes.
24962896 ERalpha expression highly correlates with ZNF217 in lysates from breast tumors.
24615544 Study investigated nested regulatory circuits of miR-200c/ZEB1 and miR-200c/ZNF217/TGF-beta/ZEB1 in synergistically promoting trastuzumab resistance and metastasis of breast cancer cells.
24336158 Synergic effects of loss of ARID1A and PI3K-Akt pathway activation as well as ZNF217 amplification may be related to the development of ovarian clear cell carcinoma.
23436653 New insights into DNA recognition by zinc fingers revealed by structural analysis of the oncoprotein ZNF217.
More...

AA Sequence

MQSKVTGNMPTQSLLMYMDGPEVIGSSLGSPMEMEDALSMKGTAVVPFRATQEKNVIQIEGYMPLDCMFC      1 - 70
SQTFTHSEDLNKHVLMQHRPTLCEPAVLRVEAEYLSPLDKSQVRTEPPKEKNCKENEFSCEVCGQTFRVA     71 - 140
FDVEIHMRTHKDSFTYGCNMCGRRFKEPWFLKNHMRTHNGKSGARSKLQQGLESSPATINEVVQVHAAES    141 - 210
ISSPYKICMVCGFLFPNKESLIEHRKVHTKKTAFGTSSAQTDSPQGGMPSSREDFLQLFNLRPKSHPETG    211 - 280
KKPVRCIPQLDPFTTFQAWQLATKGKVAICQEVKESGQEGSTDNDDSSSEKELGETNKGSCAGLSQEKEK    281 - 350
CKHSHGEAPSVDADPKLPSSKEKPTHCSECGKAFRTYHQLVLHSRVHKKDRRAGAESPTMSVDGRQPGTC    351 - 420
SPDLAAPLDENGAVDRGEGGSEDGSEDGLPEGIHLDKNDDGGKIKHLTSSRECSYCGKFFRSNYYLNIHL    421 - 490
RTHTGEKPYKCEFCEYAAAQKTSLRYHLERHHKEKQTDVAAEVKNDGKNQDTEDALLTADSAQTKNLKRF    491 - 560
FDGAKDVTGSPPAKQLKEMPSVFQNVLGSAVLSPAHKDTQDFHKNAADDSADKVNKNPTPAYLDLLKKRS    561 - 630
AVETQANNLICRTKADVTPPPDGSTTHNLEVSPKEKQTETAADCRYRPSVDCHEKPLNLSVGALHNCPAI    631 - 700
SLSKSLIPSITCPFCTFKTFYPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSS    701 - 770
FCKPKPKSAFPAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSE    771 - 840
MFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNINGSIDYPAKNDSPWAPPGRDYFCNRSASNTAA    841 - 910
EFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCVYPSQALPPKPRFLSSSEVDS    911 - 980
PNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQHLSNSMAQKRNYENFIGNAHYRPNDKKT      981 - 1048
//

Text Mined References (44)

PMID Year Title
26431164 2015 The dark side of ZNF217, a key regulator of tumorigenesis with powerful biomarker value.
25824781 2015 ZNF217 is overexpressed and enhances cell migration and invasion in colorectal carcinoma.
25729968 2015 Effect of ZNF217 gene polymorphisms on colorectal cancer development in a Mexican population.
25621839 2015 MiR-203 suppresses ZNF217 upregulation in colorectal cancer and its oncogenicity.
25202062 2014 Prognostic significance of ZNF217 expression in gastric carcinoma.
25031722 2014 ZNF217 is associated with poor prognosis and enhances proliferation and metastasis in ovarian cancer.
24962896 2014 Global analysis of ZNF217 chromatin occupancy in the breast cancer cell genome reveals an association with ERalpha.
24615544 2014 MiR-200c suppresses TGF-? signaling and counteracts trastuzumab resistance and metastasis by targeting ZNF217 and ZEB1 in breast cancer.
24336158 2014 Loss of ARID1A expression and its relationship with PI3K-Akt pathway alterations and ZNF217 amplification in ovarian clear cell carcinoma.
23436653 2013 New insights into DNA recognition by zinc fingers revealed by structural analysis of the oncoprotein ZNF217.
More...