Property Summary

NCBI Gene PubMed Count 56
PubMed Score 77.74
PubTator Score 31.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
dermatomyositis 1.600 3.0e-04
Multiple myeloma 1.225 4.6e-03
ovarian cancer -1.400 3.3e-04

Protein-protein Interaction (5)

Gene RIF (29)

AA Sequence

MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAE      1 - 70
KLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGEGESDDPEKKKLQNQLQGAIVIERPNVKWSDVAGLE     71 - 140
GAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSISSSDLVSKWLG    141 - 210
ESEKLVKNLFQLARENKPSIIFIDEIDSLCGSRSENESEAARRIKTEFLVQMQGVGVDNDGILVLGATNI    211 - 280
PWVLDSAIRRRFEKRIYIPLPEPHARAAMFKLHLGTTQNSLTEADFRELGRKTDGYSGADISIIVRDALM    281 - 350
QPVRKVQSATHFKKVRGPSRADPNHLVDDLLTPCSPGDPGAIEMTWMDVPGDKLLEPVVSMSDMLRSLSN    351 - 420
TKPTVNEHDLLKLKKFTEDFGQEG                                                  421 - 444
//

Text Mined References (68)

PMID Year Title