Property Summary

NCBI Gene PubMed Count 56
Grant Count 44
R01 Count 32
Funding $3,423,760.7
PubMed Score 70.99
PubTator Score 31.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.225 0.005
ovarian cancer -1.400 0.000
dermatomyositis 1.600 0.000

Gene RIF (30)

PMID Text
25804841 Our findings support a role for VPS4B in MM cell proliferation, adhesion, and drug resistance, and pave the way for a novel therapeutic approach targeting this molecule.
25657007 Crystal structures of three molecular complexes reveal that IST1 binds to the MIT domains of VPS4 and LIP5.
25637630 ESCRT-III protein CHMP5 inhibits LIP5-mediated VPS4 activation by inducing a moderate conformational change within LIP5.
25534348 Lack of ALG-2, ALIX or Vps4B each prevents shedding, and repair of the injured cell membrane
25533544 High Vacuolar protein sorting 4B results in more apoptosis of intestinal epithelial cells via p38 MAPK in Crohn's disease.
24440309 Protein kinase CK2 alpha is involved in the phosphorylation of the ESCRT-III subunits CHMP3 and CHMP2B, as well as of VPS4B/SKD1, an ATPase that mediates ESCRT-III disassembly.
24268138 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
24268138 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
24107264 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
23737133 VPS4B may promote the progression of Carcinoma, Non-Small-Cell Lung (NSCLC) and be a biotarget for NSCLCs therapy.
More...

AA Sequence

MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAE      1 - 70
KLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGEGESDDPEKKKLQNQLQGAIVIERPNVKWSDVAGLE     71 - 140
GAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSISSSDLVSKWLG    141 - 210
ESEKLVKNLFQLARENKPSIIFIDEIDSLCGSRSENESEAARRIKTEFLVQMQGVGVDNDGILVLGATNI    211 - 280
PWVLDSAIRRRFEKRIYIPLPEPHARAAMFKLHLGTTQNSLTEADFRELGRKTDGYSGADISIIVRDALM    281 - 350
QPVRKVQSATHFKKVRGPSRADPNHLVDDLLTPCSPGDPGAIEMTWMDVPGDKLLEPVVSMSDMLRSLSN    351 - 420
TKPTVNEHDLLKLKKFTEDFGQEG                                                  421 - 444
//

Text Mined References (68)

PMID Year Title
27247351 2016 A splicing mutation in VPS4B causes dentin dysplasia I.
25804841 2015 Cell adhesion down-regulates the expression of vacuolar protein sorting 4B (VPS4B) and contributes to drug resistance in multiple myeloma cells.
25657007 2015 Distinct mechanisms of recognizing endosomal sorting complex required for transport III (ESCRT-III) protein IST1 by different microtubule interacting and trafficking (MIT) domains.
25637630 2015 A novel mechanism of regulating the ATPase VPS4 by its cofactor LIP5 and the endosomal sorting complex required for transport (ESCRT)-III protein CHMP5.
25534348 2014 Mechanism of Ca²?-triggered ESCRT assembly and regulation of cell membrane repair.
25533544 2015 Vacuolar protein sorting 4B regulates apoptosis of intestinal epithelial cells via p38 MAPK in Crohn's disease.
25416956 2014 A proteome-scale map of the human interactome network.
24440309 2014 CK2 involvement in ESCRT-III complex phosphorylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24107264 2013 ESCRT requirements for EIAV budding.
More...