Property Summary

NCBI Gene PubMed Count 39
Grant Count 39
R01 Count 24
Funding $5,071,097.27
PubMed Score 94.50
PubTator Score 47.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma -1.300 0.000
cystic fibrosis 1.473 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.100 0.003
medulloblastoma, large-cell -1.500 0.000
tuberculosis -1.300 0.000
adult high grade glioma -1.500 0.000
group 4 medulloblastoma -1.300 0.000
subependymal giant cell astrocytoma -1.058 0.043
pituitary cancer 1.700 0.000
psoriasis 1.100 0.000

Gene RIF (22)

PMID Text
26752048 SEMA7A has a role in the development of lung injury
26597008 This study demonstrates that Sema7A controls the assembly of actin-based protrusions that drive Dendritic cell migration in response to CCL21.
26432853 Sema3A and sema7A expression correlated with the inflammatory activity of the multiple sclerosis (MS) lesions, suggesting their involvement in the immunological process that takes place in MS.
25406498 These results suggest that SEMA7a plays a role as a CSF biomarkers associated with the conversion to clinically definite multiple sclerosis in clinically isolated syndromes patients
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of semaphorin 7A, GPI membrane anchor (SEMA7A, CD108)
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of semaphorin 7A, GPI membrane anchor (SEMA7A, CD108)
24522099 heterozygous missense variants in SEMA3A and SEMA7A may modify the phenotype of Kallmann syndrome but most likely are not alone sufficient to cause the disorder
24333536 Semaphorin 7A is a potentially important modulator of eosinophil profibrotic functions in the airway remodeling of patients with chronic asthma.
23850082 SEMA7A was expressed in the liver and was increased in the course of liver fibrosis, both in mice and in humans.
23166499 two MTRAP monomers interact via their tandem TSR domains with the Sema domains of a Semaphorin-7A homodimer
More...

AA Sequence

MTPPPPGRAAPSAPRARVPGPPARLGLPLRLRLLLLLWAAAASAQGHLRSGPRIFAVWKGHVGQDRVDFG      1 - 70
QTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGL     71 - 140
LACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGDEVYSTIRKQEYNGKIPRFRRIRGES    141 - 210
ELYTSDTVMQNPQFIKATIVHQDQAYDDKIYYFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSK    211 - 280
WNTFLKAMLVCSDAATNKNFNRLQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSS    281 - 350
LKGYHSSLPNPRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASH    351 - 420
GETFHVLYLTTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVSSQWEVSQVPL    421 - 490
DLCEVYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNS    491 - 560
RYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLL    561 - 630
PEDGIMAEHLLGHACALAASLWLGVLPTLTLGLLVH                                      631 - 666
//

Text Mined References (40)

PMID Year Title
26752048 2016 Semaphorin 7A Aggravates Pulmonary Inflammation during Lung Injury.
26597008 2016 Semaphorin 7A Promotes Chemokine-Driven Dendritic Cell Migration.
26432853 2015 Expression of semaphorin 3A, semaphorin 7A and their receptors in multiple sclerosis lesions.
25406498 2014 Validation of semaphorin 7A and ala-?-his-dipeptidase as biomarkers associated with the conversion from clinically isolated syndrome to multiple sclerosis.
24522099 2014 Mutation screening of SEMA3A and SEMA7A in patients with congenital hypogonadotropic hypogonadism.
24333536 2014 Semaphorin 7A is expressed on airway eosinophils and upregulated by IL-5 family cytokines.
23850082 2013 Semaphorin 7A contributes to TGF-?-mediated liver fibrogenesis.
23166499 2012 Semaphorin-7A is an erythrocyte receptor for P. falciparum merozoite-specific TRAP homolog, MTRAP.
22891341 2012 Endothelial Semaphorin 7A promotes neutrophil migration during hypoxia.
22845496 2013 Semaphorin 7A protein variants differentially regulate T-cell activity.
More...