Property Summary

NCBI Gene PubMed Count 42
PubMed Score 103.49
PubTator Score 47.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.500 1.2e-04
atypical teratoid / rhabdoid tumor -1.700 6.2e-09
cystic fibrosis 1.473 8.4e-05
ependymoma -1.300 3.7e-08
glioblastoma -1.100 2.6e-03
group 4 medulloblastoma -1.300 4.2e-04
medulloblastoma, large-cell -1.500 3.0e-04
pituitary cancer 1.700 3.9e-05
psoriasis 1.100 1.0e-30
subependymal giant cell astrocytoma -1.058 4.3e-02
tuberculosis -1.300 1.5e-06

 GWAS Trait (1)

Gene RIF (24)

AA Sequence

MTPPPPGRAAPSAPRARVPGPPARLGLPLRLRLLLLLWAAAASAQGHLRSGPRIFAVWKGHVGQDRVDFG      1 - 70
QTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGL     71 - 140
LACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGDEVYSTIRKQEYNGKIPRFRRIRGES    141 - 210
ELYTSDTVMQNPQFIKATIVHQDQAYDDKIYYFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSK    211 - 280
WNTFLKAMLVCSDAATNKNFNRLQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSS    281 - 350
LKGYHSSLPNPRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASH    351 - 420
GETFHVLYLTTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVSSQWEVSQVPL    421 - 490
DLCEVYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNS    491 - 560
RYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLL    561 - 630
PEDGIMAEHLLGHACALAASLWLGVLPTLTLGLLVH                                      631 - 666
//

Text Mined References (43)

PMID Year Title