Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.36
PubTator Score 5.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 7.3e-05
Multiple myeloma 1332 1.8e-04
Waldenstrons macroglobulinemia 765 1.4e-02

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.620 1.8e-04
ovarian cancer -1.400 7.3e-05
Waldenstrons macroglobulinemia 1.051 1.4e-02

Gene RIF (6)

AA Sequence

MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLFVRKVDPRKDAHSNLLAKKET      1 - 70
SNLYKLQFHNVKPECLEAYNKICQEVLPKIHEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEV     71 - 140
MNKLRENKEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMIEWGNYWARAI    141 - 210
RFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPL    211 - 280
KTSPLQ                                                                    281 - 286
//

Text Mined References (22)

PMID Year Title