Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.37
PubTator Score 5.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.051 0.014
Multiple myeloma 1.620 0.000
ovarian cancer 1.900 0.001

Synonym

Accession O75323 C9IYJ3 O43801 Q53X96 NipSnap2
Symbols NIPSNAP2

Gene

Gene RIF (4)

PMID Text
24137763 GBAS mutations could not explain phenotype of patients with combined oxidative phosphorylation system deficiencies.
20888800 CHCHD10 and GBAS are involved in oxidative phosphorylation.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of glioblastoma amplified sequence (GBAS) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLFVRKVDPRKDAHSNLLAKKET      1 - 70
SNLYKLQFHNVKPECLEAYNKICQEVLPKIHEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEV     71 - 140
MNKLRENKEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMIEWGNYWARAI    141 - 210
RFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPL    211 - 280
KTSPLQ                                                                    281 - 286
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25126726 2014 FLCN, a novel autophagy component, interacts with GABARAP and is regulated by ULK1 phosphorylation.
24137763 2010 Sequence variants in four candidate genes (NIPSNAP1, GBAS, CHCHD1 and METT11D1) in patients with combined oxidative phosphorylation system deficiencies.
21269460 2011 Initial characterization of the human central proteome.
20888800 2010 Functional annotation of heart enriched mitochondrial genes GBAS and CHCHD10 through guilt by association.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20562859 2010 Network organization of the human autophagy system.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16381901 2006 The LIFEdb database in 2006.
More...